Seq-entry ::= set { level 1 , class nuc-prot , descr { source { org { taxname "Homo sapiens" , common "human" , db { { db "taxon" , tag id 9606 } } , orgname { name binomial { genus "Homo" , species "sapiens" } , lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo" , gcode 1 , mgcode 2 , div "PRI" } } } , pub { pub { pmid 6571704 , article { title { name "Organization of the human myoglobin gene." } , authors { names std { { name name { last "Weller" , initials "P." } } , { name name { last "Jeffreys" , initials "A.J." } } , { name name { last "Wilson" , initials "V." } } , { name name { last "Blanchetot" , initials "A." } } } } , from journal { title { iso-jta "EMBO J." , ml-jta "EMBO J" , issn "0261-4189" , name "The EMBO journal" } , imp { date std { year 1984 , month 2 } , volume "3" , issue "2" , pages "439-446" , language "eng" , pubstatus ppublish , history { { pubstatus pubmed , date std { year 1984 , month 2 , day 1 } } , { pubstatus medline , date std { year 1984 , month 2 , day 1 , hour 0 , minute 1 } } , { pubstatus other , date std { year 1984 , month 2 , day 1 , hour 0 , minute 0 } } } } } , ids { pubmed 6571704 , other { db "pmc" , tag str "PMC557363" } } } } } , comment "Data kindly reviewed (09-MAY-1985) by P. Weller" , create-date std { year 1985 , month 2 , day 20 } , update-date std { year 2006 , month 11 , day 14 } } , seq-set { seq { id { embl { accession "X00371" , version 1 } , gi 34607 } , descr { title "Human myoglobin gene (exon 1) (and joined CDS)" , molinfo { biomol genomic } , embl { creation-date std { year 1985 , month 2 , day 20 } , update-date std { year 2006 , month 11 , day 14 } , keywords { "direct repeat" , "myoglobin" , "tandem repeat" } , xref { { dbname code epd , id { str "EP11091" , str "HS_MB" } } , { dbname name "GDB" , id { str "181633" } } , { dbname name "GDB" , id { str "9873378" } } } } } , inst { repr raw , mol dna , length 3768 , seq-data ncbi2na '5DE15FFAD9CA2D25874B112874783A2110A75D4A8BA69D3A435C83AD149 4A7F22151122A6F78540BE47AA0750BFAA3DFE0FC1DFFDC9C4FD73CFED43DF1404DDEF44F7827A 8DE1E92272C8E7873D23A25784FA7F749FA7B87A492BF9A881EEED5204E1E9C45E45D2423EA92A 4BCDF4009EECAEA92D3C7840D4B921528E95011E9F35FDE0DD375449EC09AAEB9D9C5D122BBEC0 8F23B0DF9424947FB01ECCB7CE48E8282A5EE5C5F8D32470101EC7B3FD3D77CBCDD5C008778BD7 E044A0AEFF3F8FFBCD7493B24BB78444B2B9DCD1EE22A3A3A3ABA2F123A320A323A2A3ABA38E8E 8C8E8E8AAA38E0E8A8C38BA3838A83ABA3A3A3A2A3A281232323A2A3ABAB8E8E8C8E8E8A8A8E38 3A2A30E0E8E0E2A8EAE8E8E0E8A8E3ABA38383E2A3A3A38113A3A3A323A323A281EBA3FE8E8EAE 8E8C8E0E0E5E8C84088E3A323832383C2A3B68C8E8A8F8C8EFA3A3ABAE8E8C8E2E0E4E8C84088E 3A3A383C2A3848E8E8E8E2C1E8E842E8C0E8C8EBE0C5E0E8F828A393A3B08C29C34D751DDFDFE4 014D454FC743013F3D2F407E9102453B8A542231BABC300489D795D7801E4080AA6E9F5E2F40D5 0779498727B134B8EFD5C7F7743C0CA8C3B4B17344FA8ADF9AA3C0E2F140E50BBFA84A97A45490 2DDFB8B9E9E73CD70E8823A4E005280CA395FEA090E41281F11020280A28243CBAEDD028B3B420 01FF48A805FE24A94E004A2F77088FBA1F97A8517A7309100535AF5FDED1F7A6AE2AB77A40AA48 2B9B88AF983A4A1ED7A525AA45EBA509F201384AD77EA2A78592A26FABF4A79E9B69F7BAE57F7B 69CE22D484B9505D755F7F5119105154557BA5E27B5E5D9443A45E5700C9F54EE2A722028023C8 5757A3888880B828A92A8AA849894F898DFED0935482B300195FA852925D01549EFAA528454B89 531F9DFFEDF7D21E653AA74986A83A4BEB9E06DEAA0AE8A784D5294EA4A0B5D34AC028223D4F95 7945445708D0ABBD2790AE80BF91BAACAD2FA793CBC2AEF206B47E7FF7F9FF0BB4A8FA1D288A80 A253F4A78CD249E8A093883405CA39D22D452820FF20F3212D22F042AD7888FFB1251777C4A38A 100261E20AA284FD48B449D3C0E77C0BB42BC2139DF42A8848DEBDC87E9DE51E251EAE17FA82B1 D05DDA25D0FD775EC4B8AA335C337335C8A23B883C0C030E4E42297A4EBD7A4CC78B5C80EF2C9C F1E38254A72A17F4093E43C881208C8A74F2E17D8EF8B3B772FE22B7838EEB790B335E5F71442A 3D483114080100F78AFEC0C8ABA7BAFEC4C8274DD76F97DCD502B8C477DDFA55F57453DE27AF57 482DC32BC20D06FDE506A28282EA65A'H } , annot { { data ftable { { data imp { key "repeat_region" } , location int { from 830 , to 1481 , id gi 34607 } , qual { { qual "rpt_type" , val "TANDEM" } } } , { data imp { key "repeat_region" } , location int { from 867 , to 982 , id gi 34607 } , qual { { qual "rpt_type" , val "DIRECT" } } } , { data imp { key "repeat_region" } , location int { from 995 , to 1111 , id gi 34607 } , qual { { qual "rpt_type" , val "DIRECT" } } } , { data imp { key "repeat_region" } , location int { from 1206 , to 1263 , id gi 34607 } , qual { { qual "rpt_type" , val "DIRECT" } } } , { data imp { key "repeat_region" } , location int { from 1322 , to 1379 , id gi 34607 } , qual { { qual "rpt_type" , val "DIRECT" } } } , { data imp { key "regulatory" } , location int { from 2547 , to 2552 , id gi 34607 } , qual { { qual "regulatory_class" , val "TATA_box" } } } , { data imp { key "exon" } , comment "label:ex1" , location int { from 2580 , to 2744 , id gi 34607 } } , { data rna { type miscRNA } , comment "cap-site" , location pnt { point 2580 , id gi 34607 } } , { data rna { type mRNA } , location mix { int { from 2580 , to 2744 , id gi 34607 } , int { from 1263 , to 1485 , id gi 34609 } , int { from 100 , to 777 , id gi 34611 } } } , { data imp { key "misc_feature" } , comment "label:start" , location int { from 2650 , to 2744 , id gi 34607 } } } } } } , seq { id { embl { accession "CAA25109" , version 1 } , gi 1235527 } , descr { title "myoglobin [Homo sapiens]" , molinfo { biomol peptide } } , inst { repr raw , mol aa , length 154 , seq-data ncbieaa "MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKAS EDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALE LFRKDMASNYKELGFQG" , hist { replaces { date std { year 1996 , month 3 , day 21 } , ids { gi 34608 } } } } , annot { { data ftable { { data prot { name { "myoglobin" } } , location int { from 0 , to 153 , id gi 1235527 } } } } } } } , annot { { data ftable { { data cdregion { frame one , code { id 1 } } , product whole gi 1235527 , location mix { int { from 2650 , to 2744 , id gi 34607 } , int { from 1263 , to 1485 , id gi 34609 } , int { from 100 , to 246 , id gi 34611 } } , dbxref { { db "GDB" , tag id 119378 } , { db "GOA" , tag str "P02144" } , { db "HGNC" , tag str "HGNC:6915" } , { db "InterPro" , tag str "IPR000971" } , { db "InterPro" , tag str "IPR002335" } , { db "InterPro" , tag str "IPR009050" } , { db "InterPro" , tag str "IPR012292" } , { db "PDB" , tag str "2MM1" } , { db "UniProtKB/Swiss-Prot" , tag str "P02144" } } } } } } }