#!/usr/bin/env python # Copyright (c) 2006 John Gilman # # This software is distributed under the MIT Open Source License. # # # Permission is hereby granted, free of charge, to any person obtaining a # copy of this software and associated documentation files (the "Software"), # to deal in the Software without restriction, including without limitation # the rights to use, copy, modify, merge, publish, distribute, sublicense, # and/or sell copies of the Software, and to permit persons to whom the # Software is furnished to do so, subject to the following conditions: # # The above copyright notice and this permission notice shall be included # in all copies or substantial portions of the Software. # # THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR # IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, # FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE # AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER # LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, # OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN # THE SOFTWARE. import unittest from weblogo.seq import (protein_alphabet, Seq, nucleic_alphabet, reduced_protein_alphabet, dna_alphabet) from weblogo.transform import mask_low_complexity, GeneticCode, Transform, reduced_protein_alphabets class test_mask_low_complexity(unittest.TestCase): def test_segging(self): before = "mgnrafkshhghflsaegeavkthhghhdhhthfhvenhggkvalkthcgkylsigdhkqvylshhlhgdhslfhlehhg"\ "gkvsikghhhhyisadhhghvstkehhdhdttfeeiii".upper() after = "MGNRAFKSHHGHFLSAEGEAVxxxxxxxxxxxxxxxENHGGKVALKTHCGKYLSIGDHKQVYLSHHLHGDHSLFHLEHHGG"\ "KVSIKGHHHHYISADHHGHVSTKEHHDHDTTFEEIII".upper() bseq = Seq(before, protein_alphabet) aseq = Seq(after, protein_alphabet) xseq = Seq('X' * len(bseq), protein_alphabet) sseq = mask_low_complexity(bseq) self.assertEqual(aseq, sseq) # Nothing should be segged sseq = mask_low_complexity(bseq, 12, 0, 0) self.assertEqual(bseq, sseq) # Everthing should be segged sseq = mask_low_complexity(bseq, 12, 4.3, 4.3) self.assertEqual(sseq, xseq) mask_low_complexity(bseq, 100000, 4.3, 4.3) def test_seg_invalid(self): seq = Seq("KTHCGKYLSIGDHKQVYLSHH", protein_alphabet) self.assertRaises(ValueError, mask_low_complexity, seq, 12, -1, 0) self.assertRaises(ValueError, mask_low_complexity, seq, -1, 0, 0) self.assertRaises(ValueError, mask_low_complexity, seq, 12, 1, 10) self.assertRaises(ValueError, mask_low_complexity, seq, 6, 12, 13) self.assertRaises(ValueError, mask_low_complexity, seq, 6, 2.0, 1.9) class test_transform(unittest.TestCase): def test_transform(self): trans = Transform(Seq("ACGTURYSWKMBDHVN", nucleic_alphabet), Seq("ACGTTNNNNNNNNNNN", dna_alphabet)) s0 = Seq("AAAAAR", nucleic_alphabet) s1 = trans(s0) # Callable ob self.assertEqual(s1.alphabet, dna_alphabet) self.assertEqual(s1, Seq("AAAAAN", dna_alphabet)) s2 = Seq(protein_alphabet, protein_alphabet) self.assertRaises(ValueError, trans, s2) # def test_translations(self): # s = Seq("ACGTURYSWKMBDHVNACGTURYSWKMBDHVN", nucleic_alphabet) # s2 = dna_ext_to_std(s) # s3 = Seq("ACGTTNNNNNNNNNNNACGTTNNNNNNNNNNN", dna_alphabet) # self.assertEqual(s2, s3) def test_reduced_protein_alphabets(self): seq = Seq("ENHGGKVALKTHCGKYLSIGDHKQVYLSHHLHGDHSLFHLEHHGGKVSIKGHHHHYISADHHGHVSTKEHHDHDT" "TFEEIII", reduced_protein_alphabet) for t in reduced_protein_alphabets.values(): t(seq) class test_geneticcode(unittest.TestCase): def test_repr(self): for t in GeneticCode.std_list(): r = repr(t) gc = eval(r) self.assertEqual(r, repr(gc)) self.assertEqual(str(gc), str(t)) # print r # print t # print gc def test_translate_std(self): dna = 'GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA' t = GeneticCode.std() s = t.translate(dna) self.assertEqual(str(s), 'AIVMGR*KGAR') for t in GeneticCode.std_list(): t.translate(dna) def test_translate(self): # Ref: http://lists.open-bio.org/pipermail/biopython/2006-March/002960.html cft = ( ("Vertebrate Mitochondrial", 'GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA', 'AIVMGRWKGAR'), (11, 'CAAGGCGTCGAAYAGCTTCAGGAACAGGAC', 'QGVE?LQEQD'), (1, 'GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA', 'AIVMGR*KGAR'), ) for code, dna, protein in cft: c = GeneticCode.by_name(code) trans = c.translate(dna) self.assertEqual(str(trans), protein) self.assertRaises(ValueError, GeneticCode.by_name, 'not_a_name') def test_back_translate(self): prot = 'ACDEFGHIKLMNPQRSTVWY*' t = GeneticCode.std() t.table['CGA'] s = t.back_translate(prot) self.assertEqual(prot, str(t.translate(s))) GeneticCode.std().back_table if __name__ == '__main__': unittest.main()