#!/usr/bin/env python # Copyright (c) 2006, The Regents of the University of California, through # Lawrence Berkeley National Laboratory (subject to receipt of any required # approvals from the U.S. Dept. of Energy). All rights reserved. # This software is distributed under the new BSD Open Source License. # # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions are met: # # (1) Redistributions of source code must retain the above copyright notice, # this list of conditions and the following disclaimer. # # (2) Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and or other materials provided with the distribution. # # (3) Neither the name of the University of California, Lawrence Berkeley # National Laboratory, U.S. Dept. of Energy nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" # AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. import unittest from io import StringIO from weblogo.seq import dna_alphabet, protein_alphabet from weblogo.seq_io import clustal_io, nbrf_io, plain_io from . import data_stream class test_nbrf_io(unittest.TestCase): def test_parse_cox2(self): f = data_stream("cox2.nbrf") seqs = nbrf_io.read(f) self.assertEqual(len(seqs), 5) self.assertEqual(len(seqs[1]), 210) self.assertEqual( str(seqs[0]), "MAFILSFWMIFLLDSVIVLLSFVCFVCVWICALLFSTVLLVSKLNNIYCTWDFTASKFIDVYWFTIGGMFSLG" "LLLRLCLLLYFGHLNFVSFDLCKVVGFQWYWVYFIFGETTIFSNLILESDYMIGDLRLLQCNHVLTLLSLVIY" "KLWLSAVDVIHSFAISSLGVKVENLVAVMK", ) self.assertEqual(seqs[0].alphabet, protein_alphabet) f.close() def test_parse_crab(self): f = data_stream("crab.nbrf") seqs = nbrf_io.read(f) self.assertEqual(seqs[0].alphabet, protein_alphabet) self.assertEqual(len(seqs), 9) self.assertEqual(seqs[2].name, "CRAB_CHICK") self.assertEqual( seqs[2].description, "ALPHA CRYSTALLIN B CHAIN (ALPHA(B)-CRYSTALLIN)." ) f.close() def test_parse_dna(self): f = data_stream("dna.pir") seqs = nbrf_io.read(f) self.assertEqual(seqs[0].alphabet, dna_alphabet) self.assertEqual(len(seqs), 10) f.close() def test_parse_examples(self): f = data_stream("rhod.pir") seqs = nbrf_io.read(f) self.assertEqual(seqs[0].alphabet, protein_alphabet) self.assertEqual(len(seqs), 3) f.close() def test_parse_protein(self): f = data_stream("protein.pir") seqs = nbrf_io.read(f) self.assertEqual(seqs[0].alphabet, protein_alphabet) self.assertEqual(len(seqs), 10) f.close() def test_parse_clustal_fail(self): # should fail with parse error f = StringIO(clustal_io.example) self.assertRaises(ValueError, nbrf_io.read, f, protein_alphabet) def test_parse_plain_fail(self): # should fail with parse error f = StringIO(plain_io.example) self.assertRaises(ValueError, nbrf_io.read, f) def test_pir_file_from_clustal(self): f = data_stream("clustalw.pir") seqs = nbrf_io.read(f) self.assertEqual(len(seqs), 2) self.assertEqual( seqs[1].endswith( "C-AATC-G-CAATG-G--CTTGAACCGGGTAAAAGTCGT-A----------------------------------------" "-----------------------------------------" ), True, ) f.close() def test_parse_examples_alphabet(self): f = data_stream("rhod.pir") seqs = nbrf_io.read(f, alphabet=protein_alphabet) self.assertEqual(seqs[0].alphabet, protein_alphabet) self.assertEqual(len(seqs), 3) f.close() if __name__ == "__main__": unittest.main()