/* * BioJava development code * * This code may be freely distributed and modified under the * terms of the GNU Lesser General Public Licence. This should * be distributed with the code. If you do not have a copy, * see: * * http://www.gnu.org/copyleft/lesser.html * * Copyright for this code is held jointly by the individual * authors. These should be listed in @author doc comments. * * For more information on the BioJava project and its aims, * or to join the biojava-l mailing list, visit the home page * at: * * http://www.biojava.org/ * */ package org.biojava.bio.program.sax; import java.io.BufferedReader; import java.io.IOException; import java.util.ArrayList; import java.util.HashMap; import java.util.StringTokenizer; import org.xml.sax.Attributes; import org.xml.sax.InputSource; import org.xml.sax.SAXException; import org.xml.sax.helpers.AttributesImpl; /** * A SAX2 parser for dealing with a multiple sequence * alignment as produced by ClustalW outputing .aln format. * For example, *
  K1C0_XENLA/125-441      DKVHALETANTELERKIKEWYEKQRPGSSSGDGAKDYSKYYT
  K1C4_XENLA/81-396       EKVRALEAANADLELKIREWYEKQK-GSGIGAGSKDFSKYFE
  K1C5_XENLA/73-384       DRVRSLEQANHELELKIREYLDKK-----AAVGSLDYSGYYN
  keratin15               DKVRALEEANADLEVKIHDWYQKQTP----ASPECDYSQYFK

  K1C0_XENLA/125-441      -----AKFLLQNDNARLAADDFKMKFEN--------------
  K1C4_XENLA/81-396       -----SRVVLQIDNAKLAADDFRLKFEN--------------
  K1C5_XENLA/73-384       -----TRLVLSIDNAKLAADDFKIKYES--------------
  keratin15               -----SRVILEIDNARLAADDFRLKYEN--------------
 * 
*

* Please note, this parser reads the whole alignment in to * core memory and thus does not scale to work with very large * alignments on low-end hardware. *

* Please also note that this class has not been tested with * many version of CLUSTAL W. * * Copyright © 2000,2001 Cambridge Antibody Technology. * *

* Primary author -

* Other authors - * * @author Cambridge Antibody Technology (CAT) * @author Greg Cox * @version 1.0 * */ public class ClustalWAlignmentSAXParser extends AbstractNativeAppSAXParser { private AttributesImpl oAtts = new AttributesImpl(); private QName oAttQName = new QName(this); private char[] aoChars; private String oSeqName; private String oTmpSeq; private StringBuffer oSeq = new StringBuffer(); private HashMap oAlignment = new HashMap(); private ArrayList oSeqNameList = new ArrayList(); private static final int STARTUP = 0; private static final int IN_STREAM = 1; /** * Initialises internal state * Sets namespace prefix to "biojava" */ public ClustalWAlignmentSAXParser() { iState = STARTUP; this.setNamespacePrefix("biojava"); } /** * Describe 'parse' method here. * * @param poSource - */ public void parse(InputSource poSource ) throws IOException,SAXException { BufferedReader oContents; String oLine = null; //Use method form superclass oContents = this.getContentStream(poSource); // loop over file try { // loop over file oLine = oContents.readLine(); while (oLine != null) { //System.out.println(oLine); this.interpret(oContents,oLine); oLine = oContents.readLine(); } // end while } catch (java.io.IOException x) { System.out.println(x.getMessage()); System.out.println("Stream read interrupted"); } // end try/catch //at end of stream... //at this point, alignment is parsed, now cycle through //and emit elements for (int i = 0; i < oSeqNameList.size(); i++) { oSeqName = (String) oSeqNameList.get(i); this.emitSequence(oSeqName, (String) oAlignment.get(oSeqName)); } this.endElement(new QName(this, this.prefix("SequenceCollection"))); oContents.close(); } /** * Describe interpret method here. * * @param poContents a BufferedReader value * @param poLine a String value * @exception SAXException if an error occurs */ private void interpret(BufferedReader poContents, String poLine) throws SAXException { if (iState == STARTUP) { oAtts.clear(); this.startElement( new QName(this, this.prefix("SequenceCollection")), (Attributes)oAtts); this.changeState(IN_STREAM); } if (iState == IN_STREAM) { if (this.lineIsRelevant(poLine)) { //build aligment in memory this.appendToAlignment(poLine); } } } /** * Parse a relevant line, and add to alignment * * @param poLine a String value */ private void appendToAlignment(String poLine) { //System.out.println(poLine); StringTokenizer oSt = new StringTokenizer(poLine,"\n\t\r "); //First token is sequence name oSeqName = oSt.nextToken(); //System.out.println(oSeqName); oSeq.setLength(0); while (oSt.hasMoreTokens()) { oSeq.append(oSt.nextToken()); } //System.out.println(oSeq); //At this point, have name of sequence, and a segment of the sequence //Update object... if (oAlignment.get(oSeqName) == null) { //Here if on first occurence of this sequence //Add to alignment oAlignment.put(oSeqName,oSeq.substring(0)); //maintain ordered list of sequence names oSeqNameList.add(oSeqName); } else { //Here if building up an existing sequence oTmpSeq = (String) oAlignment.get(oSeqName); oAlignment.put(oSeqName,oTmpSeq.concat(oSeq.substring(0))); } } /** * Only interested in lines that are part of the alignment. * Returns true if line is in alignment, false if not. * * @param poLine a String value * @return a boolean value */ private boolean lineIsRelevant(String poLine) { //blank lines not relevant //lines that starts with a space not relevant (consensus line) //lines that start with "CLUSTAL W (" not relevant (title) if ( (poLine.trim().equals("")) || (poLine.startsWith(" ")) || (poLine.startsWith("CLUSTAL W (")) ) { //System.out.println("Irrelevant|"+poLine+"|"); return false; } //if here,line is part of alignment, so return true return true; } /** * Emit a sequence element * * @param poSequenceName a String value * @param poSequence a String value * @exception SAXException if an error occurs */ private void emitSequence(String poSequenceName, String poSequence) throws SAXException { oAtts.clear(); oAttQName.setQName("sequenceName"); oAtts.addAttribute(oAttQName.getURI(), oAttQName.getLocalName(), oAttQName.getQName(), "CDATA",poSequenceName); this.startElement( new QName(this, this.prefix("Sequence")), (Attributes)oAtts); aoChars = poSequence.toCharArray(); this.characters(aoChars,0,aoChars.length); this.endElement(new QName(this,this.prefix("Sequence"))); } }