# fasta3 -Q -d 20 -m 0 -s BL50 -z 1 -E 1.0e-5 bio2692695986880719814.tmp.fasta @/home/psgendb/BIRCHDEV/dat/fasta/nr.nam 2 FASTA searches a protein or DNA sequence data bank version 36.3.6 Aug., 2014(preload9) Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: bio2692695986880719814.tmp.fasta 1>>>XURTG - 222 aa Library: @/home/psgendb/BIRCHDEV/dat/fasta/nr.nam 17878177349 residues in 49814966 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.7911+/-0.000146; mu= 3.3559+/- 0.008 mean_var=57.2157+/-10.994, 0's: 172 Z-trim(115.6): 362 B-trim: 6040 in 2/61 Lambda= 0.169557 statistics sampled from 60000 (98564) to 6617731 sequences Algorithm: FASTA (3.8 Nov 2011) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.461), E-opt: 0.2 (0.133), width: 16 Scan time: 1052.690 The best scores are: opt bits E(49814966) glutathione S-transferase Ya subunit [Rattus norve ( 222) 1442 361.0 5.4e-97 ref|NP_058709.2| glutathione S-transferase alph ( 222) 1440 360.5 7.6e-97 pdb|1EV9|A Chain A, Rat Glutathione S-Transfera ( 221) 1418 355.1 3.1e-95 pdb|1EV4|A Chain A, Rat Glutathione S-transfera ( 221) 1414 354.1 6.2e-95 sp|P04903.2|GSTA2_RAT RecName: Full=Glutathione S ( 222) 1401 350.9 5.6e-94 ref|NP_001010921.1| glutathione S-transferase a ( 222) 1395 349.5 1.6e-93 glutathione transferase (EC 2.5.1.18) [Mus musculu ( 222) 1387 347.5 6.1e-93 mCG129934, isoform CRA_a [Mus musculus] ( 222) 1383 346.5 1.2e-92 ENSMUSG00000074179 protein [Mus musculus] ( 222) 1382 346.3 1.4e-92 ref|NP_032208.2| glutathione S-transferase A2 [ ( 222) 1381 346.0 1.7e-92 ref|NP_032207.3| glutathione S-transferase A1 ( 223) 1380 345.8 2e-92 ref|NP_001116132.1| uncharacterized protein LO ( 222) 1377 345.1 3.3e-92 glutathione S transferase [Mus musculus] ( 223) 1375 344.6 4.7e-92 ref|NP_001230021.1| predicted gene 3776 [Mus m ( 223) 1374 344.3 5.5e-92 pdb|1F3A|A Chain A, Crystal Structure Of Mgsta1 ( 222) 1373 344.1 6.5e-92 pdb|1ML6|A Chain A, Crystal Structure Of Mgsta2 ( 221) 1365 342.1 2.5e-91 pdb|1F3B|A Chain A, Crystal Structure Of Mgsta1 ( 222) 1358 340.4 8.3e-91 ref|XP_006996952.1| PREDICTED: glutathione S-t ( 222) 1305 327.4 6.6e-87 ref|XP_006996951.1| PREDICTED: glutathione S-t ( 222) 1295 325.0 3.6e-86 ref|XP_006995154.1| PREDICTED: LOW QUALITY PRO ( 223) 1277 320.6 7.7e-85 ref|XP_005347644.1| PREDICTED: glutathione S-t ( 222) 1267 318.1 4.2e-84 ref|XP_005347645.1| PREDICTED: glutathione S-t ( 260) 1266 317.8 6.1e-84 ref|XP_005347651.1| PREDICTED: glutathione S-t ( 222) 1243 312.3 2.4e-82 ref|XP_008844333.1| PREDICTED: glutathione S-t ( 223) 1242 312.0 2.9e-82 ref|XP_007611592.1| PREDICTED: glutathione S-t ( 223) 1232 309.6 1.6e-81 ref|XP_005347649.1| PREDICTED: glutathione S-t ( 222) 1227 308.4 3.7e-81 ref|XP_008844325.1| PREDICTED: glutathione S-t ( 222) 1227 308.4 3.7e-81 ref|XP_003503230.1| PREDICTED: glutathione S-t ( 223) 1205 303.0 1.5e-79 ref|XP_005347757.1| PREDICTED: glutathione S-t ( 223) 1198 301.3 5e-79 ref|XP_004673628.1| PREDICTED: glutathione S-t ( 223) 1196 300.8 7.1e-79 ref|XP_005318618.1| PREDICTED: glutathione S-t ( 222) 1192 299.8 1.4e-78 ref|XP_008591649.1| PREDICTED: glutathione S-t ( 222) 1190 299.3 1.9e-78 ref|XP_004466873.1| PREDICTED: glutathione S-t ( 222) 1187 298.6 3.2e-78 TPA: glutathione S-transferase A1 [Bos taurus] ( 222) 1187 298.6 3.2e-78 ref|XP_004466872.1| PREDICTED: glutathione S-t ( 270) 1187 298.5 4.2e-78 ref|XP_008591704.1| PREDICTED: glutathione S-t ( 222) 1184 297.8 5.4e-78 ref|NP_001108238.1| glutathione S-transferase ( 222) 1181 297.1 9e-78 ref|NP_001071617.1| glutathione S-transferase ( 222) 1180 296.9 1.1e-77 sp|O18879.4|GSTA2_BOVIN RecName: Full=Glutathi ( 223) 1179 296.6 1.3e-77 ref|XP_005696481.1| PREDICTED: glutathione S-t ( 222) 1178 296.4 1.5e-77 ref|XP_005957630.1| PREDICTED: glutathione S-t ( 222) 1176 295.9 2.1e-77 ref|XP_006040894.1| PREDICTED: glutathione S-t ( 222) 1175 295.6 2.5e-77 ref|XP_003254197.1| PREDICTED: glutathione S-t ( 222) 1174 295.4 2.9e-77 ref|XP_006764372.1| PREDICTED: glutathione S-t ( 222) 1173 295.1 3.5e-77 ref|XP_008155727.1| PREDICTED: glutathione S-t ( 222) 1173 295.1 3.5e-77 ref|XP_004673627.1| PREDICTED: glutathione S-t ( 223) 1173 295.1 3.5e-77 ref|XP_005696479.1| PREDICTED: glutathione S-t ( 223) 1171 294.7 4.9e-77 ref|XP_005347646.1| PREDICTED: glutathione S-t ( 225) 1170 294.4 5.9e-77 ref|XP_004660553.1| PREDICTED: glutathione S-t ( 222) 1166 293.4 1.1e-76 ref|XP_006093297.1| PREDICTED: glutathione S-t ( 222) 1165 293.2 1.3e-76 hypothetical protein EGM_13696 [Macaca fasciculari ( 222) 1165 293.2 1.3e-76 ref|XP_007934332.1| PREDICTED: glutathione S-t ( 223) 1163 292.7 1.9e-76 ref|XP_005666521.1| PREDICTED: glutathione S-t ( 223) 1162 292.5 2.3e-76 ref|XP_006168166.1| PREDICTED: glutathione S-t ( 223) 1159 291.7 3.8e-76 ref|XP_004605915.1| PREDICTED: glutathione S-t ( 223) 1159 291.7 3.8e-76 ref|XP_532173.1| PREDICTED: glutathione S-trans ( 223) 1158 291.5 4.4e-76 ref|XP_005666522.1| PREDICTED: glutathione S-t ( 223) 1156 291.0 6.2e-76 ref|XP_004018944.1| PREDICTED: glutathione S-t ( 223) 1154 290.5 8.8e-76 ref|XP_001153791.1| PREDICTED: glutathione S-t ( 222) 1153 290.3 1e-75 hypothetical protein EGK_15014 [Macaca mulatta] ( 222) 1153 290.3 1e-75 glutathione s-transferase alpha 3 [Canis lupus fam ( 223) 1153 290.3 1e-75 ref|XP_007130259.1| PREDICTED: glutathione S-t ( 222) 1151 289.8 1.4e-75 hypothetical protein EGM_13695 [Macaca fasciculari ( 222) 1151 289.8 1.4e-75 ref|XP_006835776.1| PREDICTED: glutathione S-t ( 223) 1151 289.8 1.5e-75 ref|XP_003828330.1| PREDICTED: glutathione S-t ( 222) 1150 289.5 1.7e-75 glutathione S-transferase alpha 3 [Canis lupus fam ( 223) 1150 289.5 1.7e-75 ref|XP_005957632.1| PREDICTED: glutathione S-t ( 223) 1150 289.5 1.7e-75 ref|XP_005377706.1| PREDICTED: glutathione S-t ( 222) 1149 289.3 2e-75 glutathione S-transferase alpha 3 [Capra hircus] ( 222) 1149 289.3 2e-75 ref|XP_002817048.1| PREDICTED: glutathione S-t ( 222) 1148 289.0 2.4e-75 ref|XP_007516570.1| PREDICTED: glutathione S-t ( 223) 1148 289.0 2.4e-75 ref|NP_665683.1| glutathione S-transferase A1 [ ( 222) 1147 288.8 2.9e-75 ref|XP_004771924.1| PREDICTED: glutathione S-t ( 223) 1147 288.8 2.9e-75 ref|XP_004410750.1| PREDICTED: glutathione S-t ( 223) 1147 288.8 2.9e-75 ref|XP_006835777.1| PREDICTED: glutathione S-t ( 223) 1147 288.8 2.9e-75 microsomal glutathione-S-transferase [Ovis aries] ( 222) 1146 288.5 3.4e-75 pdb|2R6K|A Chain A, Crystal Structure Of An I7 ( 222) 1146 288.5 3.4e-75 gluthione S-transferase subunit 1 (GST,EC 2.5.1.18 ( 222) 1146 288.5 3.4e-75 ref|XP_006170494.1| PREDICTED: glutathione S-t ( 222) 1145 288.3 4e-75 ref|NP_999015.1| glutathione S-transferase A2 [ ( 223) 1145 288.3 4e-75 ref|XP_003311383.1| PREDICTED: glutathione S-t ( 222) 1144 288.1 4.7e-75 ref|XP_006182422.1| PREDICTED: glutathione S-t ( 223) 1144 288.1 4.8e-75 ref|XP_005696482.1| PREDICTED: glutathione S-t ( 222) 1143 287.8 5.6e-75 pdb|1GUH|A Chain A, Structure Determination And R ( 221) 1142 287.6 6.6e-75 pdb|3ZFL|A Chain A, Crystal Structure Of The V ( 222) 1142 287.6 6.7e-75 ref|NP_001182705.1| glutathione S-transferase ( 222) 1142 287.6 6.7e-75 pdb|3ZFB|A Chain A, Crystal Structure Of The I ( 222) 1141 287.3 7.9e-75 hypothetical protein EGK_15016 [Macaca mulatta] ( 222) 1141 287.3 7.9e-75 pdb|1YDK|A Chain A, Crystal Structure Of The I2 ( 222) 1141 287.3 7.9e-75 ref|XP_007095580.1| PREDICTED: glutathione S-t ( 223) 1141 287.3 7.9e-75 ref|XP_004018947.1| PREDICTED: glutathione S-t ( 222) 1140 287.1 9.4e-75 pdb|3U6V|A Chain A, Crystal Structure Analysis ( 222) 1140 287.1 9.4e-75 ref|NP_999554.1| glutathione S-transferase alph ( 222) 1139 286.8 1.1e-74 ref|XP_006902875.1| PREDICTED: glutathione S-t ( 222) 1139 286.8 1.1e-74 glutathione S-transferase A1 [Homo sapiens] ( 222) 1139 286.8 1.1e-74 ref|XP_003431794.1| PREDICTED: glutathione S-t ( 223) 1139 286.8 1.1e-74 pdb|1GSE|A Chain A, Glutathione Transferase A1-1 ( 221) 1138 286.6 1.3e-74 ref|XP_008055879.1| PREDICTED: glutathione S-t ( 222) 1138 286.6 1.3e-74 ref|XP_006902874.1| PREDICTED: glutathione S-t ( 222) 1138 286.6 1.3e-74 ref|NP_001248197.1| glutathione S-transferase ( 222) 1137 286.3 1.6e-74 pdb|2R3X|A Chain A, Crystal Structure Of An R1 ( 222) 1137 286.3 1.6e-74 ref|XP_004018946.1| PREDICTED: glutathione S-t ( 222) 1137 286.3 1.6e-74 ref|XP_004285659.1| PREDICTED: glutathione S-t ( 223) 1137 286.3 1.6e-74 pdb|3KTL|A Chain A, Crystal Structure Of An I7 ( 221) 1136 286.1 1.8e-74 pdb|1XWG|A Chain A, Human Gst A1-1 T68e Mutant ( 221) 1136 286.1 1.8e-74 glutathione S-transferase [Ovis aries] ( 222) 1136 286.1 1.8e-74 ref|XP_007970444.1| PREDICTED: glutathione S-t ( 309) 1138 286.4 2e-74 pdb|3Q74|A Chain A, Crystal Structure Analysis ( 221) 1135 285.9 2.2e-74 ref|XP_004890809.1| PREDICTED: glutathione S-t ( 222) 1135 285.9 2.2e-74 pdb|1USB|A Chain A, Rational Design Of A Novel ( 225) 1135 285.8 2.2e-74 ref|XP_005377708.1| PREDICTED: glutathione S-t ( 222) 1134 285.6 2.6e-74 ref|XP_009203645.1| PREDICTED: glutathione S-t ( 222) 1134 285.6 2.6e-74 ref|XP_001503079.1| PREDICTED: glutathione S-t ( 222) 1133 285.4 3.1e-74 ref|XP_004424077.1| PREDICTED: glutathione S-t ( 222) 1133 285.4 3.1e-74 pdb|1PKW|A Chain A, Crystal Structure Of Human ( 222) 1132 285.1 3.6e-74 pdb|4HJ2|A Chain A, Crystal Structure Analysis ( 217) 1131 284.9 4.2e-74 ref|XP_003254198.1| PREDICTED: glutathione S-t ( 222) 1131 284.9 4.3e-74 ref|XP_518542.2| PREDICTED: glutathione S-tran ( 222) 1131 284.9 4.3e-74 ref|XP_004044244.1| PREDICTED: glutathione S-t ( 222) 1130 284.6 5.1e-74 ref|XP_003254196.1| PREDICTED: glutathione S-t ( 222) 1129 284.4 6e-74 ref|XP_007193940.1| PREDICTED: glutathione S-t ( 222) 1129 284.4 6e-74 pdb|3L0H|A Chain A, Crystal Structure Analysis ( 222) 1129 284.4 6e-74 ref|NP_001276894.1| glutathione S-transferase ( 222) 1129 284.4 6e-74 ref|XP_005377707.1| PREDICTED: glutathione S-t ( 222) 1129 284.4 6e-74 ref|XP_007451992.1| PREDICTED: glutathione S-t ( 223) 1129 284.4 6.1e-74 ref|XP_008690006.1| PREDICTED: glutathione S-t ( 223) 1129 284.4 6.1e-74 ref|XP_008690005.1| PREDICTED: glutathione S-t ( 245) 1129 284.3 6.9e-74 ref|XP_007970443.1| PREDICTED: glutathione S-t ( 222) 1128 284.1 7.2e-74 ref|XP_005911204.1| PREDICTED: glutathione S-t ( 222) 1127 283.9 8.5e-74 ref|XP_002817050.2| PREDICTED: glutathione S-t ( 283) 1128 284.0 9.9e-74 pdb|1PL2|A Chain A, Crystal Structure Of Human ( 222) 1126 283.7 1e-73 ref|NP_714543.1| glutathione S-transferase A5 [ ( 222) 1125 283.4 1.2e-73 ref|XP_007516571.1| PREDICTED: glutathione S-t ( 223) 1125 283.4 1.2e-73 glutathione S-transferase A5, isoform CRA_a [Homo ( 222) 1124 283.2 1.4e-73 ref|XP_001108174.1| PREDICTED: glutathione S-t ( 222) 1124 283.2 1.4e-73 ref|XP_003404480.1| PREDICTED: glutathione S-t ( 222) 1124 283.2 1.4e-73 ref|XP_008055882.1| PREDICTED: glutathione S-t ( 222) 1123 282.9 1.7e-73 ref|XP_004424076.1| PREDICTED: glutathione S-t ( 222) 1122 282.7 2e-73 ref|NP_001092486.1| glutathione S-transferase ( 222) 1122 282.7 2e-73 ref|XP_005957631.1| PREDICTED: glutathione S-t ( 223) 1122 282.7 2e-73 ref|XP_007970440.1| PREDICTED: glutathione S-t ( 222) 1119 281.9 3.3e-73 ref|XP_008952637.1| PREDICTED: glutathione S-t ( 222) 1119 281.9 3.3e-73 ref|NP_001182706.1| glutathione S-transferase ( 222) 1119 281.9 3.3e-73 ref|NP_000838.3| glutathione S-transferase A3 [ ( 222) 1118 281.7 3.9e-73 ref|XP_004388782.1| PREDICTED: glutathione S-t ( 223) 1118 281.7 3.9e-73 ref|XP_002746695.1| PREDICTED: glutathione S-t ( 222) 1117 281.5 4.6e-73 glutathione S-transferase A3 [Macaca mulatta] ( 222) 1117 281.5 4.6e-73 ref|XP_003732734.1| PREDICTED: glutathione S-t ( 222) 1116 281.2 5.5e-73 ref|XP_006902876.1| PREDICTED: glutathione S-t ( 223) 1116 281.2 5.5e-73 ref|NP_001271557.1| glutathione S-transferase ( 222) 1115 281.0 6.5e-73 ref|XP_003128840.1| PREDICTED: glutathione S-t ( 223) 1114 280.7 7.7e-73 glutathione S-transferase A3 [Homo sapiens] ( 228) 1114 280.7 8e-73 ref|NP_001271461.1| glutathione S-transferase ( 222) 1113 280.5 9.1e-73 glutathione S-transferase A3 [synthetic construct] ( 222) 1113 280.5 9.1e-73 glutathione S-transferase A3 [synthetic construct] ( 223) 1113 280.5 9.2e-73 ref|XP_003897787.1| PREDICTED: glutathione S-t ( 222) 1112 280.2 1.1e-72 TPA: glutathione S-transferase alpha 5 [Bos taurus ( 222) 1112 280.2 1.1e-72 ref|XP_004044246.1| PREDICTED: glutathione S-t ( 222) 1111 280.0 1.3e-72 ref|XP_002817049.1| PREDICTED: glutathione S-t ( 207) 1110 279.8 1.4e-72 ref|XP_003363772.1| PREDICTED: glutathione S-t ( 222) 1110 279.7 1.5e-72 ref|XP_003404183.1| PREDICTED: glutathione S-t ( 223) 1110 279.7 1.5e-72 glutathione S-transferase A5, isoform CRA_b, parti ( 347) 1113 280.3 1.6e-72 ref|XP_006926500.1| PREDICTED: glutathione S-t ( 223) 1109 279.5 1.8e-72 ref|XP_001153130.1| PREDICTED: glutathione S-t ( 222) 1107 279.0 2.5e-72 ref|XP_004018945.1| PREDICTED: glutathione S-t ( 224) 1107 279.0 2.5e-72 ref|XP_008529005.1| PREDICTED: LOW QUALITY PRO ( 221) 1106 278.8 3e-72 ref|XP_003833196.1| PREDICTED: glutathione S-t ( 222) 1104 278.3 4.2e-72 ref|XP_008055881.1| PREDICTED: glutathione S-t ( 223) 1104 278.3 4.2e-72 glutathione S-transferase A2 subunit [Homo sapiens ( 222) 1103 278.0 5e-72 ref|XP_004424080.1| PREDICTED: glutathione S-t ( 222) 1103 278.0 5e-72 Glutathione S-transferase A4 [Pteropus alecto] ( 514) 1109 279.1 5.4e-72 ref|NP_001270005.1| glutathione S-transferase ( 222) 1102 277.8 5.9e-72 ref|XP_008591770.1| PREDICTED: glutathione S-t ( 207) 1101 277.6 6.4e-72 ref|XP_001503116.1| PREDICTED: glutathione S-t ( 222) 1101 277.5 7e-72 glutathione S-transferase [Homo sapiens] ( 222) 1098 276.8 1.2e-71 ref|XP_008055883.1| PREDICTED: glutathione S-t ( 223) 1098 276.8 1.2e-71 pdb|2VCT|A Chain A, Glutathione Transferase A2 ( 222) 1097 276.6 1.4e-71 ref|NP_000837.3| glutathione S-transferase A2 ( 222) 1097 276.6 1.4e-71 glutathione S-transferase A2 [synthetic construct] ( 223) 1097 276.6 1.4e-71 ref|XP_002930485.1| PREDICTED: LOW QUALITY PRO ( 223) 1096 276.3 1.6e-71 pdb|1AGS|A Chain A, A Surface Mutant (G82r) Of A ( 221) 1094 275.8 2.3e-71 ref|XP_003789738.1| PREDICTED: glutathione S-t ( 282) 1095 276.0 2.6e-71 ref|XP_002817047.1| PREDICTED: glutathione S-t ( 222) 1093 275.6 2.7e-71 unnamed protein product [Homo sapiens] ( 222) 1092 275.3 3.2e-71 ref|XP_006080960.1| PREDICTED: LOW QUALITY PRO ( 222) 1089 274.6 5.3e-71 unnamed protein product [Homo sapiens] ( 222) 1088 274.4 6.3e-71 pdb|4ACS|A Chain A, Crystal Structure Of Mutan ( 222) 1086 273.9 8.9e-71 ref|XP_005878155.1| PREDICTED: glutathione S-t ( 222) 1086 273.9 8.9e-71 ref|NP_001164568.1| glutathione S-transferase ( 223) 1086 273.9 8.9e-71 ref|XP_004696412.1| PREDICTED: glutathione S-t ( 223) 1085 273.6 1.1e-70 ref|XP_006056836.1| PREDICTED: LOW QUALITY PRO ( 222) 1082 272.9 1.7e-70 pdb|3I69|A Chain A, Apo Glutathione Transferas ( 222) 1081 272.6 2.1e-70 ref|XP_005377709.1| PREDICTED: glutathione S-t ( 223) 1080 272.4 2.5e-70 ref|XP_004599505.1| PREDICTED: glutathione S-t ( 223) 1077 271.7 4.1e-70 glutathione S-transferase [Homo sapiens] ( 222) 1073 270.7 8e-70 ref|XP_007649251.1| PREDICTED: glutathione S-t ( 194) 1067 269.3 1.9e-69 ref|XP_007611590.1| PREDICTED: glutathione S-t ( 194) 1067 269.3 1.9e-69 ref|NP_803481.1| glutathione S-transferase A2 [ ( 222) 1068 269.5 1.9e-69 ref|XP_001498753.1| PREDICTED: glutathione S-t ( 222) 1066 269.0 2.6e-69 Glutathione S-transferase A1 [Cricetulus griseus] ( 331) 1068 269.3 3.2e-69 ref|XP_003789739.1| PREDICTED: glutathione S-t ( 256) 1065 268.7 3.8e-69 ref|XP_006931879.1| PREDICTED: glutathione S-t ( 238) 1064 268.5 4.1e-69 ref|XP_001503129.2| PREDICTED: glutathione S-t ( 223) 1054 266.0 2e-68 ref|XP_008509398.1| PREDICTED: LOW QUALITY PRO ( 228) 1047 264.3 6.8e-68 ref|XP_003466387.1| PREDICTED: glutathione S-t ( 222) 1046 264.1 7.8e-68 ref|XP_004424079.1| PREDICTED: glutathione S-t ( 222) 1046 264.1 7.8e-68 ref|XP_008529004.1| PREDICTED: glutathione S-t ( 222) 1043 263.3 1.3e-67 ref|NP_001166310.1| glutathione S-transferase ( 222) 1041 262.9 1.8e-67 ref|XP_004590603.1| PREDICTED: glutathione S-t ( 221) 1037 261.9 3.6e-67 ref|XP_008055880.1| PREDICTED: glutathione S-t ( 221) 1035 261.4 5e-67 ref|XP_002714434.1| PREDICTED: glutathione S-t ( 221) 1035 261.4 5e-67 ref|NP_034486.2| glutathione S-transferase A3 i ( 221) 1033 260.9 7e-67 ref|XP_008854552.1| PREDICTED: glutathione S-t ( 222) 1033 260.9 7.1e-67 ref|NP_113697.1| glutathione S-transferase alph ( 221) 1030 260.2 1.2e-66 ref|XP_007632086.1| PREDICTED: glutathione S-t ( 221) 1030 260.2 1.2e-66 ref|XP_004410758.1| PREDICTED: glutathione S-t ( 232) 1030 260.1 1.2e-66 ref|XP_006997657.1| PREDICTED: glutathione S-t ( 222) 1029 259.9 1.4e-66 ref|XP_005359909.1| PREDICTED: glutathione S-t ( 222) 1029 259.9 1.4e-66 ref|XP_005318622.1| PREDICTED: glutathione S-t ( 222) 1029 259.9 1.4e-66 ref|XP_001503123.1| PREDICTED: glutathione S-t ( 223) 1029 259.9 1.4e-66 unnamed protein product [Mus musculus] ( 221) 1028 259.7 1.6e-66 ref|XP_005358929.1| PREDICTED: LOW QUALITY PRO ( 219) 1027 259.4 1.9e-66 ref|XP_008823424.1| PREDICTED: glutathione S-t ( 241) 1027 259.4 2.2e-66 ref|XP_003926439.1| PREDICTED: glutathione S-t ( 221) 1026 259.2 2.3e-66 glutathione S-transferase alpha-3-like protein [Cr ( 263) 1026 259.1 2.9e-66 ref|NP_001268566.1| glutathione S-transferase ( 221) 1023 258.5 3.8e-66 glutathione transferase [Mus musculus domesticus] ( 221) 1022 258.2 4.5e-66 ref|XP_003513563.1| PREDICTED: glutathione S-t ( 222) 1022 258.2 4.6e-66 glutathione S-transferase alpha-3-like protein [Cr ( 415) 1026 258.9 5.3e-66 ref|NP_001164569.1| glutathione S-transferase ( 221) 1020 257.7 6.4e-66 ref|XP_004044252.1| PREDICTED: glutathione S-t ( 219) 1019 257.5 7.5e-66 ref|XP_006997659.1| PREDICTED: glutathione S-t ( 221) 1019 257.5 7.6e-66 ref|XP_003924082.1| PREDICTED: glutathione S-t ( 222) 1019 257.5 7.6e-66 ref|XP_001514974.1| PREDICTED: glutathione S-t ( 223) 1019 257.5 7.7e-66 ref|XP_002714433.1| PREDICTED: glutathione S-t ( 221) 1018 257.2 9e-66 ref|XP_003513562.1| PREDICTED: glutathione S-t ( 221) 1018 257.2 9e-66 ref|XP_006991758.1| PREDICTED: glutathione S-t ( 221) 1018 257.2 9e-66 sp|P81706.1|GSTA1_CAVPO RecName: Full=Glutathion ( 218) 1016 256.8 1.2e-65 ref|NP_001009920.1| glutathione S-transferase a ( 221) 1014 256.3 1.8e-65 ref|XP_007632087.1| PREDICTED: glutathione S-t ( 222) 1014 256.3 1.8e-65 ref|XP_006997660.1| PREDICTED: glutathione S-t ( 221) 1013 256.0 2.1e-65 ref|NP_001019532.1| glutathione S-transferase A ( 222) 1010 255.3 3.5e-65 ref|XP_004044255.1| PREDICTED: glutathione S-t ( 212) 1009 255.1 3.9e-65 ref|XP_004599510.1| PREDICTED: glutathione S-t ( 221) 1009 255.0 4.1e-65 ref|XP_005318621.1| PREDICTED: glutathione S-t ( 221) 1009 255.0 4.1e-65 ref|XP_005318620.1| PREDICTED: glutathione S-t ( 221) 1008 254.8 4.9e-65 ref|XP_002714435.1| PREDICTED: glutathione S-t ( 221) 1005 254.1 8.1e-65 ref|XP_006998669.1| PREDICTED: glutathione S-t ( 221) 1005 254.1 8.1e-65 ref|XP_005615005.1| PREDICTED: LOW QUALITY PRO ( 280) 1006 254.2 9.4e-65 ref|XP_005318619.1| PREDICTED: glutathione S-t ( 221) 1001 253.1 1.6e-64 ref|XP_007632084.1| PREDICTED: glutathione S-t ( 221) 1001 253.1 1.6e-64 ref|XP_004599777.1| PREDICTED: glutathione S-t ( 221) 996 251.9 3.7e-64 ref|XP_004424078.1| PREDICTED: LOW QUALITY PRO ( 221) 996 251.9 3.7e-64 glutathione S-transferase alpha [Rattus norvegicus ( 226) 996 251.8 3.8e-64 ref|XP_003513561.1| PREDICTED: glutathione S-t ( 221) 995 251.6 4.4e-64 glutathione S-transferase A6-like protein [Cricetu ( 227) 994 251.4 5.4e-64 ref|XP_005887083.1| PREDICTED: glutathione S-t ( 182) 991 250.7 6.7e-64 ref|XP_006991761.1| PREDICTED: glutathione S-t ( 225) 990 250.4 1.1e-63 Glutathione S-transferase A1, partial [Bos mutus] ( 194) 987 249.7 1.4e-63 ref|XP_008823427.1| PREDICTED: glutathione S-t ( 221) 987 249.7 1.7e-63 ref|XP_005906507.1| PREDICTED: glutathione S-t ( 193) 985 249.2 2e-63 Glutathione S-transferase [Podiceps cristatus] ( 221) 984 248.9 2.9e-63 Glutathione S-transferase [Picoides pubescens] ( 221) 984 248.9 2.9e-63 ref|XP_008823451.1| PREDICTED: glutathione S-t ( 223) 984 248.9 2.9e-63 ref|XP_003215484.1| PREDICTED: glutathione S-t ( 221) 983 248.7 3.4e-63 ref|XP_002714549.1| PREDICTED: glutathione S-t ( 221) 982 248.4 4e-63 ref|XP_005427957.1| PREDICTED: glutathione S-t ( 222) 982 248.4 4e-63 ref|XP_006165782.1| PREDICTED: glutathione S-t ( 182) 980 248.0 4.4e-63 ref|NP_001001777.1| glutathione S-transferase [ ( 221) 981 248.2 4.8e-63 ref|XP_006748215.1| PREDICTED: LOW QUALITY PRO ( 223) 981 248.2 4.8e-63 ref|XP_005521968.1| PREDICTED: glutathione S-t ( 221) 977 247.2 9.4e-63 Glutathione S-transferase [Gavia stellata] ( 221) 977 247.2 9.4e-63 ref|XP_004813756.1| PREDICTED: glutathione S-t ( 225) 976 247.0 1.1e-62 Glutathione S-transferase [Leptosomus discolor] ( 221) 975 246.7 1.3e-62 ref|XP_003466385.1| PREDICTED: glutathione S-t ( 217) 974 246.5 1.5e-62 Glutathione S-transferase [Egretta garzetta] ( 221) 974 246.5 1.6e-62 Glutathione S-transferase [Pterocles gutturalis] ( 221) 974 246.5 1.6e-62 ref|XP_008116178.1| PREDICTED: glutathione S-t ( 223) 973 246.2 1.9e-62 Glutathione S-transferase [Haliaeetus albicilla] ( 221) 972 246.0 2.2e-62 Glutathione S-transferase [Chlamydotis undulata ma ( 221) 972 246.0 2.2e-62 ref|XP_009082541.1| PREDICTED: glutathione S-t ( 221) 970 245.5 3.1e-62 Glutathione S-transferase [Nipponia nippon] ( 221) 969 245.2 3.6e-62 ref|XP_008261277.1| PREDICTED: LOW QUALITY PRO ( 228) 967 244.7 5.3e-62 Glutathione S-transferase [Cuculus canorus] ( 221) 965 244.3 7.2e-62 Glutathione S-transferase [Eurypyga helias] ( 221) 964 244.0 8.5e-62 Glutathione S-transferase [Tyto alba] ( 221) 963 243.8 1e-61 Glutathione S-transferase [Pelecanus crispus] ( 221) 963 243.8 1e-61 ref|XP_003204483.1| PREDICTED: glutathione S-t ( 220) 962 243.5 1.2e-61 ref|XP_006137815.1| PREDICTED: glutathione S-t ( 222) 962 243.5 1.2e-61 ref|XP_008175413.1| PREDICTED: glutathione S-t ( 222) 961 243.3 1.4e-61 ref|XP_007435222.1| PREDICTED: glutathione S-t ( 222) 960 243.0 1.7e-61 glutathione S-transferase alpha class A1.1 [Meleag ( 220) 959 242.8 2e-61 ref|XP_003641074.1| PREDICTED: glutathione S-t ( 221) 959 242.8 2e-61 ref|XP_005441929.1| PREDICTED: glutathione S-t ( 221) 959 242.8 2e-61 Glutathione S-transferase [Apaloderma vittatum] ( 221) 959 242.8 2e-61 ref|XP_003215486.1| PREDICTED: glutathione S-t ( 223) 959 242.8 2e-61 ref|XP_004890810.1| PREDICTED: LOW QUALITY PRO ( 254) 960 243.0 2e-61 Glutathione S-transferase [Cathartes aura] ( 221) 958 242.6 2.3e-61 Glutathione S-transferase, partial [Corvus brachyr ( 221) 957 242.3 2.8e-61 Glutathione S-transferase [Buceros rhinoceros silv ( 221) 957 242.3 2.8e-61 ref|XP_005506846.1| PREDICTED: glutathione S-t ( 221) 957 242.3 2.8e-61 ref|XP_005238186.1| PREDICTED: glutathione S-t ( 222) 957 242.3 2.8e-61 ref|XP_008635870.1| PREDICTED: glutathione S-t ( 222) 957 242.3 2.8e-61 ref|XP_006024547.1| PREDICTED: glutathione S-t ( 222) 956 242.1 3.3e-61 ref|XP_009092944.1| PREDICTED: glutathione S-t ( 221) 955 241.8 3.9e-61 ref|XP_007435220.1| PREDICTED: glutathione S-t ( 221) 954 241.6 4.6e-61 ref|XP_009286838.1| PREDICTED: glutathione S-t ( 221) 954 241.6 4.6e-61 ref|XP_009096025.1| PREDICTED: glutathione S-t ( 222) 954 241.6 4.7e-61 ref|XP_005506847.1| PREDICTED: glutathione S-t ( 222) 954 241.6 4.7e-61 Glutathione S-transferase [Caprimulgus carolinensi ( 221) 953 241.3 5.5e-61 ref|XP_008947000.1| PREDICTED: glutathione S-t ( 221) 953 241.3 5.5e-61 ref|NP_001232758.1| putative glutathione S-tra ( 222) 953 241.3 5.5e-61 ref|NP_001001776.1| glutathione S-transferase [ ( 222) 953 241.3 5.5e-61 ref|XP_001370731.2| PREDICTED: glutathione S-t ( 310) 955 241.7 6.1e-61 Glutathione S-transferase, partial [Haliaeetus alb ( 220) 952 241.1 6.5e-61 Glutathione S-transferase [Pygoscelis adeliae] ( 221) 952 241.1 6.5e-61 ref|XP_005238185.1| PREDICTED: glutathione S-t ( 221) 951 240.8 7.7e-61 Glutathione S-transferase [Columba livia] ( 221) 951 240.8 7.7e-61 ref|XP_005153262.1| PREDICTED: glutathione S-t ( 222) 951 240.8 7.7e-61 ref|XP_008924135.1| PREDICTED: glutathione S-t ( 222) 950 240.6 9.2e-61 ref|XP_005506845.1| PREDICTED: glutathione S-t ( 255) 951 240.8 9.3e-61 ref|XP_002195892.1| PREDICTED: glutathione S-t ( 221) 949 240.4 1.1e-60 ref|XP_008635871.1| PREDICTED: glutathione S-t ( 222) 949 240.4 1.1e-60 ref|XP_005426438.1| PREDICTED: glutathione S-t ( 222) 949 240.4 1.1e-60 ref|XP_008951887.1| PREDICTED: glutathione S-t ( 225) 949 240.3 1.1e-60 glutathione transferase [Homo sapiens] ( 201) 948 240.2 1.1e-60 ref|XP_005496027.1| PREDICTED: glutathione S-t ( 222) 948 240.1 1.3e-60 Glutathione S-transferase, partial [Cariama crista ( 220) 947 239.9 1.5e-60 ref|XP_005521965.1| PREDICTED: glutathione S-t ( 222) 947 239.9 1.5e-60 ref|XP_004424489.1| PREDICTED: glutathione S-t ( 240) 947 239.8 1.7e-60 Glutathione S-transferase [Fulmarus glacialis] ( 221) 946 239.6 1.8e-60 ref|XP_005249091.1| PREDICTED: glutathione S-t ( 225) 946 239.6 1.8e-60 Glutathione S-transferase, partial [Leptosomus dis ( 220) 945 239.4 2.1e-60 ref|XP_005009259.1| PREDICTED: glutathione S-t ( 221) 945 239.4 2.1e-60 ref|XP_005153261.1| PREDICTED: glutathione S-t ( 221) 945 239.4 2.1e-60 ref|XP_005044247.1| PREDICTED: glutathione S-t ( 222) 945 239.4 2.1e-60 glutathione S-transferase alpha class A2 [Meleagri ( 222) 945 239.4 2.1e-60 Glutathione S-transferase, partial [Buceros rhinoc ( 220) 944 239.1 2.5e-60 Glutathione S-transferase, partial [Tyto alba] ( 220) 944 239.1 2.5e-60 glutathione S-transferase alpha class A1.3 [Meleag ( 221) 944 239.1 2.5e-60 putative glutathione S-transferase class-alpha var ( 222) 944 239.1 2.5e-60 glutathione S-transferase alpha 3 [Mus musculus] ( 198) 943 238.9 2.6e-60 Glutathione S-transferase, partial [Chlamydotis un ( 220) 943 238.9 3e-60 Glutathione S-transferase, partial [Eurypyga helia ( 220) 943 238.9 3e-60 Glutathione S-transferase [Nestor notabilis] ( 221) 943 238.9 3e-60 glutathione S-transferase alpha 3 [Mus spretus] ( 198) 942 238.7 3.1e-60 ref|XP_006109265.1| PREDICTED: glutathione S-t ( 190) 941 238.5 3.4e-60 Glutathione S-transferase A2 [Fukomys damarensis] ( 322) 945 239.2 3.5e-60 Glutathione S-transferase, partial [Phoenicopterus ( 220) 942 238.6 3.5e-60 Glutathione S-transferase, partial [Gavia stellata ( 220) 942 238.6 3.5e-60 Glutathione S-transferase, partial [Pygoscelis ade ( 220) 942 238.6 3.5e-60 glutathione S-transferase alpha class A1.3 [Meleag ( 221) 942 238.6 3.5e-60 ref|XP_008591857.1| PREDICTED: glutathione S-t ( 405) 946 239.3 4e-60 Glutathione S-transferase, partial [Calypte anna] ( 220) 941 238.4 4.2e-60 Glutathione S-transferase, partial [Phaethon leptu ( 220) 941 238.4 4.2e-60 ref|XP_008493851.1| PREDICTED: glutathione S-t ( 222) 941 238.4 4.2e-60 ref|XP_009092963.1| PREDICTED: glutathione S-t ( 222) 941 238.4 4.2e-60 ref|XP_009083124.1| PREDICTED: glutathione S-t ( 222) 940 238.2 5e-60 ref|XP_005009262.1| PREDICTED: glutathione S-t ( 222) 940 238.2 5e-60 ref|XP_006093318.1| PREDICTED: glutathione S-t ( 212) 939 237.9 5.6e-60 ref|XP_008115855.1| PREDICTED: glutathione S-t ( 223) 939 237.9 6e-60 Glutathione S-transferase, partial [Caprimulgus ca ( 220) 938 237.7 6.9e-60 Glutathione S-transferase, partial [Pelecanus cris ( 220) 937 237.4 8.2e-60 glutathione S-transferase alpha class A2 [Meleagri ( 222) 937 237.4 8.3e-60 Glutathione S-transferase, partial [Nipponia nippo ( 220) 936 237.2 9.7e-60 Glutathione S-transferase, partial [Podiceps crist ( 220) 934 236.7 1.4e-59 Glutathione S-transferase [Opisthocomus hoazin] ( 221) 933 236.4 1.6e-59 Glutathione S-transferase, partial [Acanthisitta c ( 220) 932 236.2 1.9e-59 ref|XP_005044243.1| PREDICTED: glutathione S-t ( 222) 932 236.2 1.9e-59 ref|XP_007055118.1| PREDICTED: glutathione S-t ( 225) 931 235.9 2.3e-59 Glutathione S-transferase, partial [Nestor notabil ( 220) 930 235.7 2.7e-59 Glutathione S-transferase [Cathartes aura] ( 222) 930 235.7 2.7e-59 Glutathione S-transferase [Phalacrocorax carbo] ( 222) 929 235.5 3.2e-59 ref|XP_006764374.1| PREDICTED: glutathione S-t ( 212) 927 235.0 4.3e-59 Glutathione S-transferase [Picoides pubescens] ( 222) 927 235.0 4.5e-59 ref|XP_004449926.1| PREDICTED: glutathione S-t ( 222) 927 235.0 4.5e-59 ref|XP_003789693.1| PREDICTED: glutathione S-t ( 222) 927 235.0 4.5e-59 ref|XP_003215487.1| PREDICTED: glutathione S-t ( 223) 927 235.0 4.6e-59 Glutathione S-transferase [Chaetura pelagica] ( 221) 926 234.7 5.3e-59 ref|XP_003510475.1| PREDICTED: glutathione S-t ( 222) 926 234.7 5.4e-59 Glutathione S-transferase, partial [Merops nubicus ( 220) 925 234.5 6.3e-59 Glutathione S-transferase, partial [Struthio camel ( 221) 925 234.5 6.3e-59 ref|XP_005153260.1| PREDICTED: glutathione S-t ( 222) 925 234.5 6.4e-59 ref|XP_008938534.1| PREDICTED: glutathione S-t ( 222) 925 234.5 6.4e-59 ref|XP_005441928.1| PREDICTED: glutathione S-t ( 222) 923 234.0 8.9e-59 ref|XP_005313582.1| PREDICTED: glutathione S-t ( 225) 923 234.0 9.1e-59 ref|XP_001370704.1| PREDICTED: glutathione S-t ( 231) 923 234.0 9.4e-59 ref|XP_005238184.1| PREDICTED: glutathione S-t ( 222) 922 233.8 1.1e-58 Glutathione S-transferase 3 [Tauraco erythrolophus ( 222) 921 233.5 1.3e-58 ref|XP_004771923.1| PREDICTED: glutathione S-t ( 222) 921 233.5 1.3e-58 ref|XP_004673629.1| PREDICTED: glutathione S-t ( 222) 921 233.5 1.3e-58 Glutathione S-transferase, partial [Fulmarus glaci ( 221) 920 233.3 1.5e-58 ref|XP_007055117.1| PREDICTED: glutathione S-t ( 222) 919 233.0 1.8e-58 ref|XP_007516569.1| PREDICTED: glutathione S-t ( 222) 919 233.0 1.8e-58 Glutathione S-transferase, partial [Chaetura pelag ( 220) 918 232.8 2.1e-58 ref|XP_005426439.1| PREDICTED: glutathione S-t ( 225) 918 232.8 2.1e-58 ref|XP_008924127.1| PREDICTED: glutathione S-t ( 225) 918 232.8 2.1e-58 ref|XP_004771922.1| PREDICTED: glutathione S-t ( 333) 921 233.3 2.1e-58 ref|XP_005486065.1| PREDICTED: glutathione S-t ( 222) 917 232.5 2.5e-58 ref|XP_005073765.1| PREDICTED: glutathione S-t ( 222) 917 232.5 2.5e-58 Glutathione S-transferase 3 [Fulmarus glacialis] ( 222) 917 232.5 2.5e-58 ref|XP_009083122.1| PREDICTED: glutathione S-t ( 225) 917 232.5 2.5e-58 Glutathione S-transferase 3, partial [Caprimulgus ( 221) 916 232.3 2.9e-58 ref|XP_002923004.1| PREDICTED: glutathione S-t ( 222) 916 232.3 2.9e-58 Glutathione S-transferase 3 [Tyto alba] ( 222) 916 232.3 2.9e-58 Glutathione S-transferase 3 [Egretta garzetta] ( 222) 915 232.0 3.5e-58 Glutathione S-transferase [Cuculus canorus] ( 222) 915 232.0 3.5e-58 ref|XP_005521967.1| PREDICTED: glutathione S-t ( 225) 915 232.0 3.5e-58 ref|XP_006748218.1| PREDICTED: glutathione S-t ( 248) 915 232.0 4e-58 Glutathione S-transferase 3 [Apaloderma vittatum] ( 222) 914 231.8 4.1e-58 ref|XP_009286844.1| PREDICTED: glutathione S-t ( 222) 914 231.8 4.1e-58 ref|XP_004628378.1| PREDICTED: glutathione S-t ( 307) 916 232.1 4.5e-58 Glutathione S-transferase, partial [Mesitornis uni ( 220) 913 231.6 4.8e-58 ref|XP_003204484.1| PREDICTED: glutathione S-t ( 222) 912 231.3 5.8e-58 ref|XP_005318617.1| PREDICTED: glutathione S-t ( 222) 912 231.3 5.8e-58 ref|XP_008493854.1| PREDICTED: glutathione S-t ( 222) 912 231.3 5.8e-58 ref|XP_008493853.1| PREDICTED: glutathione S-t ( 221) 911 231.1 6.8e-58 Glutathione S-transferase 3, partial [Calypte anna ( 221) 911 231.1 6.8e-58 ref|XP_008175410.1| PREDICTED: glutathione S-t ( 221) 911 231.1 6.8e-58 ref|XP_005044244.1| PREDICTED: glutathione S-t ( 222) 911 231.1 6.8e-58 Glutathione S-transferase 3 [Phaethon lepturus] ( 222) 911 231.1 6.8e-58 Glutathione S-transferase 3 [Nipponia nippon] ( 222) 911 231.1 6.8e-58 Glutathione S-transferase 3 [Phalacrocorax carbo] ( 222) 911 231.1 6.8e-58 ref|XP_008175411.1| PREDICTED: glutathione S-t ( 223) 911 231.1 6.9e-58 ref|XP_006024546.1| PREDICTED: glutathione S-t ( 222) 910 230.8 8.1e-58 ref|XP_006835778.1| PREDICTED: glutathione S-t ( 222) 910 230.8 8.1e-58 ref|XP_005223564.1| PREDICTED: glutathione S-t ( 222) 910 230.8 8.1e-58 Glutathione S-transferase A2 [Myotis brandtii] ( 266) 911 231.0 8.7e-58 ref|XP_003431795.1| PREDICTED: glutathione S-t ( 223) 909 230.6 9.6e-58 ref|XP_009092955.1| PREDICTED: glutathione S-t ( 225) 909 230.6 9.8e-58 Glutathione S-transferase 3, partial [Leptosomus d ( 221) 908 230.3 1.1e-57 ref|XP_005427958.1| PREDICTED: glutathione S-t ( 222) 908 230.3 1.1e-57 ref|XP_006763249.1| PREDICTED: glutathione S-t ( 222) 908 230.3 1.1e-57 ref|XP_006137814.1| PREDICTED: glutathione S-t ( 225) 908 230.3 1.2e-57 Glutathione S-transferase 3 [Eurypyga helias] ( 222) 907 230.1 1.3e-57 Glutathione S-transferase A4 [Myotis davidii] ( 262) 908 230.2 1.4e-57 ref|XP_001499151.1| PREDICTED: glutathione S-t ( 222) 905 229.6 1.9e-57 ref|XP_009092932.1| PREDICTED: glutathione S-t ( 222) 905 229.6 1.9e-57 ref|XP_003404479.1| PREDICTED: glutathione S-t ( 222) 905 229.6 1.9e-57 ref|XP_008823426.1| PREDICTED: glutathione S-t ( 238) 905 229.6 2.1e-57 glutathione S-transferase alpha class A1.2 [Meleag ( 221) 904 229.3 2.2e-57 ref|XP_005518153.1| PREDICTED: glutathione S-t ( 222) 904 229.3 2.2e-57 Glutathione S-transferase 3 [Mesitornis unicolor] ( 222) 904 229.3 2.2e-57 ref|XP_008919518.1| PREDICTED: LOW QUALITY PRO ( 223) 904 229.3 2.3e-57 Glutathione S-transferase 3, partial [Chaetura pel ( 221) 903 229.1 2.6e-57 Glutathione S-transferase 3, partial [Cuculus cano ( 221) 903 229.1 2.6e-57 glutathione S-transferase alpha class A1.2 [Meleag ( 221) 903 229.1 2.6e-57 ref|XP_007095581.1| PREDICTED: glutathione S-t ( 222) 903 229.1 2.7e-57 ref|XP_003128841.1| PREDICTED: glutathione S-t ( 222) 903 229.1 2.7e-57 ref|XP_002193687.1| PREDICTED: glutathione S-t ( 222) 903 229.1 2.7e-57 ref|XP_004044253.1| PREDICTED: LOW QUALITY PRO ( 231) 903 229.1 2.8e-57 ref|XP_008690004.1| PREDICTED: glutathione S-t ( 222) 902 228.9 3.1e-57 ref|XP_007934331.1| PREDICTED: glutathione S-t ( 222) 902 228.9 3.1e-57 Glutathione S-transferase 3 [Pygoscelis adeliae] ( 221) 901 228.6 3.7e-57 Glutathione S-transferase 3 [Gavia stellata] ( 222) 901 228.6 3.7e-57 ref|XP_006093299.1| PREDICTED: glutathione S-t ( 222) 901 228.6 3.7e-57 ref|XP_001510995.1| PREDICTED: glutathione S-t ( 222) 901 228.6 3.7e-57 ref|XP_005878151.1| PREDICTED: glutathione S-t ( 222) 901 228.6 3.7e-57 ref|NP_001070580.1| glutathione S-transferase ( 222) 901 228.6 3.7e-57 ref|XP_003986286.1| PREDICTED: glutathione S-t ( 222) 900 228.4 4.4e-57 ref|XP_008139913.1| PREDICTED: glutathione S-t ( 222) 900 228.4 4.4e-57 ref|XP_008946999.1| PREDICTED: glutathione S-t ( 221) 899 228.1 5.2e-57 glutathione S-transferase alpha class A1.2 [Meleag ( 221) 899 228.1 5.2e-57 hypothetical protein M91_15871 [Bos mutus] ( 231) 899 228.1 5.5e-57 Glutathione S-transferase 3 [Opisthocomus hoazin] ( 221) 898 227.9 6.2e-57 ref|XP_006165778.1| PREDICTED: glutathione S-t ( 222) 898 227.9 6.2e-57 ref|XP_009082542.1| PREDICTED: glutathione S-t ( 222) 898 227.9 6.2e-57 Glutathione S-transferase 3 [Haliaeetus albicilla] ( 222) 897 227.6 7.3e-57 ref|XP_004388789.1| PREDICTED: glutathione S-t ( 238) 897 227.6 8e-57 ref|XP_004649784.1| PREDICTED: glutathione S-t ( 252) 897 227.6 8.7e-57 ref|XP_001235594.2| PREDICTED: glutathione S-t ( 222) 896 227.4 8.7e-57 ref|XP_008055891.1| PREDICTED: glutathione S-t ( 222) 896 227.4 8.7e-57 hypothetical protein L345_14402, partial [Ophiopha ( 258) 897 227.6 8.9e-57 ref|XP_007435218.1| PREDICTED: glutathione S-t ( 230) 896 227.4 9.1e-57 ref|XP_001370648.1| PREDICTED: glutathione S-t ( 238) 896 227.4 9.5e-57 ref|XP_009286836.1| PREDICTED: glutathione S-t ( 221) 895 227.1 1e-56 Glutathione S-transferase 3, partial [Chlamydotis ( 221) 895 227.1 1e-56 ref|XP_007055119.1| PREDICTED: glutathione S-t ( 221) 895 227.1 1e-56 glutathione S-transferase:ISOTYPE=omega ( 191) 893 226.7 1.2e-56 ref|XP_002714436.1| PREDICTED: glutathione S-t ( 222) 894 226.9 1.2e-56 ref|XP_852870.2| PREDICTED: glutathione S-tran ( 222) 894 226.9 1.2e-56 Glutathione S-transferase 3 [Buceros rhinoceros si ( 222) 894 226.9 1.2e-56 ref|XP_003769200.1| PREDICTED: glutathione S-t ( 232) 894 226.9 1.3e-56 ref|XP_343546.2| PREDICTED: glutathione S-trans ( 238) 894 226.9 1.3e-56 ref|XP_004606022.1| PREDICTED: glutathione S-t ( 238) 893 226.6 1.6e-56 Glutathione S-transferase 3 [Cariama cristata] ( 222) 892 226.4 1.7e-56 ref|XP_004018948.1| PREDICTED: glutathione S-t ( 222) 891 226.2 2e-56 ref|XP_005377672.1| PREDICTED: glutathione S-t ( 222) 891 226.2 2e-56 ref|XP_006024545.1| PREDICTED: glutathione S-t ( 223) 891 226.2 2e-56 ref|XP_005377671.1| PREDICTED: glutathione S-t ( 245) 891 226.1 2.3e-56 ref|XP_002746696.1| PREDICTED: glutathione S-t ( 222) 889 225.7 2.8e-56 Glutathione S-transferase [Phalacrocorax carbo] ( 228) 889 225.7 2.9e-56 ref|XP_004605916.1| PREDICTED: glutathione S-t ( 222) 888 225.4 3.4e-56 glutathione S-transferase alpha class A3 [Meleagri ( 223) 888 225.4 3.4e-56 Glutathione S-transferase 3 [Picoides pubescens] ( 221) 887 225.2 4e-56 glutathione S-transferase alpha class A3 [Meleagri ( 223) 887 225.2 4e-56 ref|NP_034487.2| glutathione S-transferase A4 ( 222) 886 224.9 4.7e-56 ref|NP_001100310.1| glutathione S-transferase ( 222) 886 224.9 4.7e-56 ref|XP_006056837.1| PREDICTED: glutathione S-t ( 222) 885 224.7 5.6e-56 ref|NP_990149.1| glutathione S-transferase alph ( 223) 885 224.7 5.6e-56 ref|XP_006985733.1| PREDICTED: glutathione S-t ( 222) 884 224.5 6.6e-56 ref|XP_004388783.1| PREDICTED: glutathione S-t ( 222) 884 224.5 6.6e-56 pdb|1GUK|A Chain A, Crystal Structure Of Murine ( 222) 884 224.5 6.6e-56 unnamed protein product [Mus musculus] ( 222) 884 224.5 6.6e-56 ref|XP_005009257.1| PREDICTED: glutathione S-t ( 223) 884 224.5 6.7e-56 ref|XP_006835834.1| PREDICTED: glutathione S-t ( 238) 884 224.4 7.3e-56 ref|XP_005957628.1| PREDICTED: glutathione S-t ( 222) 883 224.2 7.9e-56 unnamed protein product [Mus musculus] ( 222) 882 224.0 9.3e-56 ref|XP_003926438.1| PREDICTED: glutathione S-t ( 222) 882 224.0 9.3e-56 ref|XP_538962.2| PREDICTED: glutathione S-tran ( 255) 883 224.1 9.5e-56 alpha-class glutathione S-transferase omega 1 subu ( 169) 879 223.4 1.1e-55 ref|XP_003513565.1| PREDICTED: glutathione S-t ( 238) 881 223.7 1.2e-55 ref|XP_006262468.1| PREDICTED: glutathione S-t ( 223) 880 223.5 1.3e-55 ref|XP_007632091.1| PREDICTED: glutathione S-t ( 238) 880 223.4 1.4e-55 ref|XP_006902873.1| PREDICTED: glutathione S-t ( 222) 879 223.2 1.6e-55 Glutathione S-transferase 3 [Colius striatus] ( 222) 878 223.0 1.8e-55 pdb|1B48|A Chain A, Crystal Structure Of Mgsta4- ( 221) 877 222.7 2.2e-55 ref|XP_005506843.1| PREDICTED: glutathione S-t ( 229) 876 222.5 2.7e-55 Glutathione S-transferase A1, partial [Myotis bran ( 180) 874 222.1 2.7e-55 ref|XP_007516586.1| PREDICTED: glutathione S-t ( 238) 876 222.5 2.8e-55 ref|XP_005088152.1| PREDICTED: glutathione S-t ( 193) 874 222.1 3e-55 Glutathione S-transferase 3 [Columba livia] ( 221) 874 222.0 3.6e-55 ref|XP_004696411.1| PREDICTED: glutathione S-t ( 222) 874 222.0 3.6e-55 ref|NP_990743.1| glutathione S-transferase 3 [G ( 229) 874 222.0 3.8e-55 ref|XP_005696483.1| PREDICTED: glutathione S-t ( 222) 873 221.8 4.3e-55 ref|XP_006024542.1| PREDICTED: glutathione S-t ( 230) 873 221.7 4.5e-55 ref|XP_006137813.1| PREDICTED: glutathione S-t ( 221) 872 221.5 5.1e-55 Glutathione S-transferase 3, partial [Anas platyrh ( 227) 872 221.5 5.2e-55 ref|XP_005009254.1| PREDICTED: glutathione S-t ( 229) 872 221.5 5.3e-55 Glutathione S-transferase 3 [Pygoscelis adeliae] ( 229) 871 221.3 6.3e-55 ref|XP_005869542.1| PREDICTED: uncharacterized ( 381) 874 221.8 7.4e-55 ref|XP_001370757.1| PREDICTED: glutathione S-t ( 221) 869 220.8 8.4e-55 Glutathione S-transferase 3 [Mesitornis unicolor] ( 229) 869 220.8 8.8e-55 ref|XP_005318909.1| PREDICTED: LOW QUALITY PRO ( 238) 869 220.8 9.3e-55 ref|XP_006170495.1| PREDICTED: glutathione S-t ( 238) 869 220.8 9.3e-55 ref|XP_003780369.1| PREDICTED: LOW QUALITY PRO ( 241) 869 220.7 9.4e-55 Glutathione S-transferase 3 [Phalacrocorax carbo] ( 229) 868 220.5 1e-54 ref|XP_004044251.1| PREDICTED: glutathione S-t ( 206) 866 220.1 1.3e-54 ref|XP_003404185.1| PREDICTED: glutathione S-t ( 238) 867 220.3 1.3e-54 Glutathione S-transferase 3 [Opisthocomus hoazin] ( 229) 866 220.0 1.5e-54 ref|XP_003769199.1| PREDICTED: glutathione S-t ( 237) 866 220.0 1.5e-54 Glutathione S-transferase 3 [Nestor notabilis] ( 222) 865 219.8 1.7e-54 Glutathione S-transferase 3 [Picoides pubescens] ( 229) 865 219.8 1.7e-54 Glutathione S-transferase 3 [Nipponia nippon] ( 229) 865 219.8 1.7e-54 ref|XP_006262469.1| PREDICTED: glutathione S-t ( 230) 865 219.8 1.7e-54 ref|XP_008992822.1| PREDICTED: glutathione S-t ( 205) 864 219.6 1.8e-54 ref|XP_003204481.1| PREDICTED: glutathione S-t ( 229) 864 219.5 2.1e-54 ref|XP_006182443.1| PREDICTED: glutathione S-t ( 234) 864 219.5 2.1e-54 ref|XP_004674092.1| PREDICTED: glutathione S-t ( 238) 864 219.5 2.2e-54 ref|XP_008635869.1| PREDICTED: LOW QUALITY PRO ( 221) 863 219.3 2.3e-54 ref|XP_006211595.1| PREDICTED: glutathione S-t ( 222) 863 219.3 2.3e-54 ref|XP_003215482.1| PREDICTED: glutathione S-t ( 223) 863 219.3 2.4e-54 glutathione S-transferase alpha class A4 [Meleagri ( 229) 863 219.3 2.4e-54 ref|XP_008946997.1| PREDICTED: glutathione S-t ( 229) 863 219.3 2.4e-54 ref|XP_006902883.1| PREDICTED: glutathione S-t ( 238) 863 219.3 2.6e-54 ref|XP_006715135.1| PREDICTED: glutathione S-t ( 172) 860 218.7 2.8e-54 Glutathione S-transferase 3 [Buceros rhinoceros si ( 229) 862 219.1 2.9e-54 ref|XP_008635867.1| PREDICTED: glutathione S-t ( 229) 862 219.1 2.9e-54 Glutathione S-transferase 3 [Cuculus canorus] ( 229) 861 218.8 3.4e-54 ref|XP_003474815.1| PREDICTED: glutathione S-t ( 298) 863 219.2 3.5e-54 ref|XP_003750590.1| PREDICTED: glutathione S-t ( 222) 860 218.6 3.9e-54 Glutathione S-transferase 3 [Apaloderma vittatum] ( 229) 860 218.6 4.1e-54 Glutathione S-transferase 3 [Chaetura pelagica] ( 229) 859 218.3 4.8e-54 ref|XP_009082543.1| PREDICTED: glutathione S-t ( 229) 858 218.1 5.7e-54 Glutathione S-transferase 3 [Pelecanus crispus] ( 229) 857 217.8 6.7e-54 Glutathione S-transferase 3 [Pterocles gutturalis] ( 223) 856 217.6 7.7e-54 hypothetical protein L345_13113 [Ophiophagus hanna ( 230) 856 217.6 8e-54 ref|XP_008690007.1| PREDICTED: glutathione S-t ( 238) 856 217.6 8.4e-54 ref|XP_006137812.1| PREDICTED: glutathione S-t ( 224) 855 217.4 9.2e-54 ref|XP_005313577.1| PREDICTED: glutathione S-t ( 224) 854 217.1 1.1e-53 ref|XP_006748216.1| PREDICTED: LOW QUALITY PRO ( 222) 853 216.9 1.3e-53 Glutathione S-transferase 3 [Tyto alba] ( 229) 853 216.9 1.3e-53 ref|XP_005427959.1| PREDICTED: glutathione S-t ( 229) 853 216.9 1.3e-53 ref|XP_007649253.1| PREDICTED: glutathione S-t ( 232) 853 216.9 1.4e-53 ref|XP_003775364.1| PREDICTED: LOW QUALITY PRO ( 221) 852 216.6 1.5e-53 Glutathione S-transferase 3 [Struthio camelus aust ( 223) 852 216.6 1.5e-53 ref|XP_003215480.1| PREDICTED: glutathione S-t ( 229) 852 216.6 1.6e-53 ref|XP_005044242.1| PREDICTED: glutathione S-t ( 229) 851 216.4 1.9e-53 ref|XP_004644680.1| PREDICTED: glutathione S-t ( 223) 850 216.1 2.1e-53 ref|XP_007435219.1| PREDICTED: glutathione S-t ( 225) 850 216.1 2.2e-53 ref|XP_009092921.1| PREDICTED: glutathione S-t ( 229) 850 216.1 2.2e-53 ref|XP_006024557.1| PREDICTED: glutathione S-t ( 225) 849 215.9 2.6e-53 Glutathione S-transferase 3 [Caprimulgus carolinen ( 229) 849 215.9 2.6e-53 ref|XP_005518154.1| PREDICTED: glutathione S-t ( 229) 849 215.9 2.6e-53 ref|XP_005369628.1| PREDICTED: glutathione S-t ( 238) 848 215.6 3.3e-53 ref|XP_005486063.1| PREDICTED: glutathione S-t ( 229) 846 215.1 4.4e-53 ref|XP_008946998.1| PREDICTED: glutathione S-t ( 214) 844 214.7 5.6e-53 alpha-class glutathione S-transferase omega 2 subu ( 169) 842 214.3 5.7e-53 ref|XP_008919519.1| PREDICTED: glutathione S-t ( 227) 843 214.4 7.2e-53 Glutathione S-transferase 3 [Tauraco erythrolophus ( 229) 843 214.4 7.2e-53 Glutathione S-transferase A4 [Myotis brandtii] ( 207) 842 214.2 7.5e-53 ref|NP_001279946.1| glutathione S-transferase ( 222) 842 214.2 8.2e-53 Glutathione S-transferase A1 [Tupaia chinensis] ( 166) 839 213.6 9.3e-53 ref|XP_006262488.1| PREDICTED: glutathione S-t ( 223) 841 213.9 9.8e-53 ref|XP_005613651.1| PREDICTED: glutathione S-t ( 254) 840 213.6 1.4e-52 glutathione S-transferase 3-like protein [Callorhi ( 222) 837 213.0 1.9e-52 glutathione S-transferase Ya subunit, partial [Rat ( 133) 833 212.2 1.9e-52 Glutathione S-transferase 3 [Haliaeetus albicilla] ( 229) 837 212.9 2e-52 ref|XP_003340467.1| PREDICTED: glutathione S-t ( 220) 835 212.5 2.7e-52 Glutathione S-transferase 3, partial [Aptenodytes ( 228) 835 212.5 2.8e-52 ref|XP_009286835.1| PREDICTED: glutathione S-t ( 229) 835 212.5 2.8e-52 Glutathione S-transferase alpha-4 [Tupaia chinensi ( 207) 834 212.3 2.9e-52 ref|XP_007095619.1| PREDICTED: glutathione S-t ( 239) 835 212.4 3e-52 ref|XP_003769201.1| PREDICTED: glutathione S-t ( 220) 834 212.2 3.2e-52 glutathione S-transferase alpha [Hypophthalmichthy ( 223) 834 212.2 3.2e-52 unnamed protein product [Rattus norvegicus] ( 129) 827 210.8 5.1e-52 ref|XP_003215481.1| PREDICTED: glutathione S-t ( 227) 831 211.5 5.5e-52 Glutathione S-transferase 3 [Phaethon lepturus] ( 229) 830 211.2 6.6e-52 ref|XP_006748217.1| PREDICTED: glutathione S-t ( 238) 826 210.2 1.4e-51 ref|XP_004424490.1| PREDICTED: glutathione S-t ( 263) 825 209.9 1.8e-51 ref|XP_004410759.1| PREDICTED: LOW QUALITY PRO ( 234) 822 209.3 2.6e-51 glutathione S-transferase alpha [Hypophthalmichthy ( 223) 820 208.8 3.5e-51 ref|XP_008509383.1| PREDICTED: glutathione S-t ( 238) 819 208.5 4.5e-51 ref|XP_007970439.1| PREDICTED: glutathione S-t ( 218) 815 207.6 7.8e-51 sp|P80894.1|GSTA1_ANTST RecName: Full=Glutathion ( 221) 814 207.3 9.4e-51 glutathione S-transferase [Pimephales promelas] ( 223) 814 207.3 9.5e-51 ref|XP_004628379.1| PREDICTED: uncharacterized ( 349) 815 207.4 1.5e-50 ref|XP_004044250.1| PREDICTED: glutathione S-t ( 265) 805 205.0 5.5e-50 Glutathione S-transferase, partial [Cariama crista ( 194) 802 204.5 6.1e-50 ref|XP_006165776.1| PREDICTED: glutathione S-t ( 222) 801 204.2 8.6e-50 ref|XP_008592136.1| PREDICTED: glutathione S-t ( 239) 801 204.1 9.5e-50 ref|XP_003311396.1| PREDICTED: glutathione S-t ( 208) 798 203.4 1.3e-49 ref|XP_008055884.1| PREDICTED: glutathione S-t ( 222) 798 203.4 1.4e-49 ref|XP_008592076.1| PREDICTED: glutathione S-t ( 241) 796 202.9 2.2e-49 ref|XP_008592019.1| PREDICTED: glutathione S-t ( 244) 796 202.9 2.3e-49 ref|XP_008592202.1| PREDICTED: glutathione S-t ( 216) 794 202.5 2.7e-49 ref|XP_003789694.1| PREDICTED: glutathione S-t ( 222) 794 202.4 2.8e-49 glutathione S-transferase [Tanichthys albonubes] ( 223) 794 202.4 2.8e-49 ref|XP_008591962.1| PREDICTED: glutathione S-t ( 250) 794 202.4 3.3e-49 ref|XP_008957113.1| PREDICTED: glutathione S-t ( 209) 792 202.0 3.7e-49 ref|XP_008591903.1| PREDICTED: glutathione S-t ( 281) 794 202.3 3.8e-49 ref|XP_006211594.1| PREDICTED: glutathione S-t ( 222) 792 201.9 4e-49 ref|XP_006182423.1| PREDICTED: glutathione S-t ( 223) 792 201.9 4e-49 glutathione S-transferase alpha [Channa punctata] ( 224) 792 201.9 4e-49 ref|XP_007130257.1| PREDICTED: glutathione S-t ( 223) 790 201.5 5.6e-49 glutathione S-transferase alpha [Cyprinus carpio] ( 223) 790 201.5 5.6e-49 glutathione S-transferase alpha [Carassius auratus ( 221) 789 201.2 6.5e-49 ref|NP_001245031.1| glutathione S-transferase ( 222) 789 201.2 6.6e-49 ref|XP_004285660.1| PREDICTED: glutathione S-t ( 223) 788 201.0 7.8e-49 ref|NP_998559.1| glutathione S-transferase, alp ( 223) 788 201.0 7.8e-49 ref|XP_006931860.1| PREDICTED: glutathione S-t ( 222) 787 200.7 9.2e-49 ref|XP_004410751.1| PREDICTED: glutathione S-t ( 222) 787 200.7 9.2e-49 ref|XP_004599504.1| PREDICTED: glutathione S-t ( 222) 787 200.7 9.2e-49 hypothetical protein PANDA_012064 [Ailuropoda mela ( 222) 787 200.7 9.2e-49 ref|XP_006835779.1| PREDICTED: glutathione S-t ( 222) 787 200.7 9.2e-49 ref|XP_002922998.1| PREDICTED: glutathione S-t ( 223) 787 200.7 9.3e-49 ref|XP_008690001.1| PREDICTED: glutathione S-t ( 223) 787 200.7 9.3e-49 ref|XP_002817053.1| PREDICTED: glutathione S-t ( 207) 786 200.5 1e-48 ref|XP_004771921.1| PREDICTED: glutathione S-t ( 222) 786 200.5 1.1e-48 unnamed protein product [Oncorhynchus mykiss] ( 222) 786 200.5 1.1e-48 ref|XP_004673630.1| PREDICTED: glutathione S-t ( 222) 786 200.5 1.1e-48 ref|XP_002746697.1| PREDICTED: glutathione S-t ( 222) 786 200.5 1.1e-48 ref|NP_001230308.1| glutathione S-transferase ( 223) 786 200.5 1.1e-48 ref|NP_001187537.1| glutathione S-transferase ( 223) 786 200.5 1.1e-48 ref|NP_001239153.1| glutathione S-transferase ( 222) 785 200.2 1.3e-48 ref|NP_001096118.1| zgc:173961 [Danio rerio] Z ( 223) 785 200.2 1.3e-48 ref|NP_001089496.1| glutathione S-transferase ( 229) 785 200.2 1.4e-48 ref|XP_002714551.1| PREDICTED: glutathione S-t ( 222) 784 200.0 1.5e-48 ref|NP_001275546.1| glutathione S-transferase ( 171) 781 199.4 1.8e-48 unnamed protein product [Oncorhynchus mykiss] ( 222) 783 199.7 1.8e-48 ref|NP_001015651.1| glutathione S-transferase A ( 222) 783 199.7 1.8e-48 mCG7907 [Mus musculus] ( 223) 783 199.7 1.8e-48 ref|XP_004605917.1| PREDICTED: glutathione S-t ( 222) 782 199.5 2.2e-48 glutathione S-transferase A4-like protein [Cricetu ( 235) 782 199.5 2.3e-48 ref|XP_004424075.1| PREDICTED: glutathione S-t ( 222) 781 199.3 2.6e-48 ref|XP_001503157.1| PREDICTED: glutathione S-t ( 222) 781 199.3 2.6e-48 ref|XP_518543.1| PREDICTED: uncharacterized pro ( 222) 781 199.3 2.6e-48 ref|XP_007651982.1| PREDICTED: glutathione S-t ( 172) 779 198.9 2.6e-48 ref|XP_003466498.2| PREDICTED: glutathione S-t ( 252) 781 199.2 3e-48 ref|XP_003926437.1| PREDICTED: glutathione S-t ( 222) 780 199.0 3e-48 ref|XP_005318616.1| PREDICTED: glutathione S-t ( 222) 779 198.8 3.6e-48 ref|XP_007632088.1| PREDICTED: glutathione S-t ( 172) 777 198.4 3.6e-48 ref|XP_004696615.1| PREDICTED: glutathione S-t ( 222) 777 198.3 5e-48 Glutathione S-transferase 3 [Lepeophtheirus salmon ( 222) 777 198.3 5e-48 ref|NP_001016676.1| glutathione S-transferase a ( 233) 777 198.3 5.4e-48 ref|NP_001503.1| glutathione S-transferase A4 [H ( 222) 776 198.0 6e-48 glutathione S-transferase A4 [synthetic construct] ( 223) 776 198.0 6e-48 Glutathione S-transferase, partial [Colius striatu ( 192) 773 197.4 8.2e-48 ref|NP_001273954.1| glutathione S-transferase ( 171) 770 196.7 1.2e-47 ref|NP_001103201.1| uncharacterized protein LO ( 223) 772 197.1 1.2e-47 Glutathione S-transferase 3 [Esox lucius] ( 222) 771 196.8 1.4e-47 ref|XP_002817052.1| PREDICTED: glutathione S-t ( 253) 772 197.0 1.4e-47 Glutathione S-transferase alpha 4 [Bos taurus] ( 222) 770 196.6 1.6e-47 ref|XP_006926883.1| PREDICTED: glutathione S-t ( 218) 769 196.3 1.9e-47 ref|XP_003404182.1| PREDICTED: glutathione S-t ( 222) 769 196.3 2e-47 ref|XP_004644669.1| PREDICTED: glutathione S-t ( 222) 769 196.3 2e-47 ref|XP_001100346.2| PREDICTED: glutathione S-t ( 207) 768 196.1 2.1e-47 ref|XP_008150138.1| PREDICTED: glutathione S-t ( 223) 768 196.1 2.3e-47 ref|NP_001091163.1| glutathione S-transferase ( 220) 767 195.8 2.7e-47 Unknown (protein for MGC:114977) [Xenopus laevis] ( 220) 767 195.8 2.7e-47 ref|XP_007516568.1| PREDICTED: glutathione S-t ( 222) 767 195.8 2.7e-47 ref|XP_005878154.1| PREDICTED: glutathione S-t ( 223) 767 195.8 2.8e-47 GSTA4, partial [synthetic construct] ( 222) 765 195.3 3.8e-47 ref|XP_005313580.1| PREDICTED: glutathione S-t ( 207) 762 194.6 5.8e-47 ref|XP_005313581.1| PREDICTED: glutathione S-t ( 184) 760 194.2 7e-47 ref|XP_008957114.1| PREDICTED: LOW QUALITY PRO ( 232) 759 193.9 1.1e-46 ref|XP_008320262.1| PREDICTED: glutathione S-t ( 220) 756 193.1 1.7e-46 ref|XP_008854551.1| PREDICTED: glutathione S-t ( 172) 753 192.5 2.1e-46 Glutathione S-transferase 3 [Chelonia mydas] ( 456) 760 193.8 2.3e-46 ref|XP_006093298.1| PREDICTED: glutathione S-t ( 223) 752 192.2 3.5e-46 ref|XP_003204482.1| PREDICTED: glutathione S-t ( 201) 748 191.2 6e-46 Glutathione S-transferase 3, partial [Pelecanus cr ( 184) 746 190.8 7.5e-46 ref|XP_008823428.1| PREDICTED: glutathione S-t ( 171) 744 190.3 9.6e-46 glutathione S-transferase [Carassius auratus] ( 197) 744 190.3 1.2e-45 glutathione S-transferase 3-like protein [Cricetul ( 681) 753 191.9 1.3e-45 ref|XP_006998888.1| PREDICTED: glutathione S-t ( 131) 740 189.5 1.3e-45 ref|XP_006262486.1| PREDICTED: glutathione S-t ( 194) 743 190.0 1.3e-45 alpha-class glutathione S-transferase [Epinephelus ( 223) 739 189.0 3.2e-45 Glutathione S-transferase, partial [Phoenicopterus ( 175) 736 188.4 3.8e-45 glutathione S-transferase [Oplegnathus fasciatus] ( 223) 737 188.5 4.5e-45 Glutathione S-transferase, partial [Phaethon leptu ( 175) 731 187.1 9e-45 ref|XP_005009256.1| PREDICTED: glutathione S-t ( 301) 733 187.4 1.3e-44 Glutathione S-transferase 3 [Anoplopoma fimbria] ( 223) 730 186.8 1.5e-44 glutathione S-transferase [Pagrus major] ( 222) 729 186.5 1.7e-44 phosphodiesterase 8b [Cavia porcellus] ( 138) 724 185.5 2.1e-44 glutathione S-transferase class-alpha [Gallus gall ( 186) 726 185.9 2.3e-44 ref|XP_005506844.1| PREDICTED: glutathione S-t ( 277) 728 186.2 2.7e-44 glutathione-S-transferase alpha [Solea senegalensi ( 222) 726 185.8 2.9e-44 glutathione S-transferase 3 [Sparus aurata] ( 222) 726 185.8 2.9e-44 glutathione S-transferase [Pagrus major] ( 223) 726 185.8 2.9e-44 ref|XP_007484154.1| PREDICTED: glutathione S-t ( 243) 724 185.3 4.5e-44 Glutathione S-transferase, partial [Tauraco erythr ( 175) 721 184.7 4.9e-44 ref|XP_004077240.1| PREDICTED: glutathione S-t ( 223) 722 184.8 5.7e-44 ref|XP_002934902.1| PREDICTED: glutathione S-t ( 220) 721 184.6 6.6e-44 ref|XP_004464003.1| PREDICTED: glutathione S-t ( 171) 719 184.2 6.7e-44 ref|XP_005737221.1| PREDICTED: glutathione S-t ( 222) 721 184.6 6.7e-44 Glutathione S-transferase A4 [Corvus brachyrhyncho ( 204) 720 184.4 7.1e-44 ref|XP_004914545.1| PREDICTED: glutathione S-t ( 232) 721 184.6 7.1e-44 ref|XP_002934900.1| PREDICTED: glutathione S-t ( 235) 721 184.6 7.2e-44 ref|XP_002934901.1| PREDICTED: glutathione S-t ( 247) 721 184.5 7.7e-44 ref|XP_004555990.1| PREDICTED: glutathione S-t ( 222) 720 184.3 7.9e-44 ref|XP_005627530.1| PREDICTED: glutathione S-t ( 235) 720 184.3 8.5e-44 ref|XP_006211617.1| PREDICTED: LOW QUALITY PRO ( 247) 719 184.0 1.1e-43 glutathione S-transferase [Paralichthys olivaceus] ( 220) 717 183.6 1.3e-43 gluthathione S-transferase alpha [Takifugu obscuru ( 223) 716 183.4 1.6e-43 Glutathione S-transferase, partial [Cathartes aura ( 176) 714 183.0 1.6e-43 Glutathione S-transferase, partial [Phoenicopterus ( 175) 713 182.7 1.9e-43 alpha-class glutathione S-transferase [Oreochromis ( 222) 713 182.6 2.6e-43 ref|XP_008428004.1| PREDICTED: glutathione S-t ( 223) 713 182.6 2.6e-43 ref|XP_003964141.1| PREDICTED: glutathione S-t ( 223) 713 182.6 2.6e-43 ref|NP_001266564.1| glutathione S-transferase ( 222) 711 182.1 3.6e-43 ref|XP_005915603.1| PREDICTED: glutathione S-t ( 220) 710 181.9 4.3e-43 ref|XP_004555991.1| PREDICTED: glutathione S-t ( 220) 709 181.7 5.1e-43 ref|XP_005737220.1| PREDICTED: glutathione S-t ( 220) 706 180.9 8.4e-43 ref|XP_006800791.1| PREDICTED: glutathione S-t ( 220) 705 180.7 1e-42 Glutathione S-transferase 3, partial [Chlamydotis ( 201) 704 180.5 1e-42 Glutathione S-transferase 3, partial [Balearica pa ( 201) 704 180.5 1e-42 glutathione S-transferase alpha [Siganus canalicul ( 194) 702 180.0 1.4e-42 ref|XP_007546195.1| PREDICTED: glutathione S-t ( 223) 703 180.2 1.4e-42 unnamed protein product [Tetraodon nigroviridis] ( 218) 702 179.9 1.6e-42 glutathione S-transferase [Kryptolebias marmoratus ( 221) 699 179.2 2.8e-42 ref|XP_007892238.1| PREDICTED: glutathione S-t ( 188) 697 178.8 3.1e-42 ref|XP_003441039.2| PREDICTED: glutathione S-t ( 278) 698 178.9 4.4e-42 ref|XP_009096036.1| PREDICTED: glutathione S-t ( 199) 695 178.3 4.8e-42 glutathione S-transferase, partial [Carassius aura ( 185) 694 178.1 5.1e-42 ref|XP_008295786.1| PREDICTED: glutathione S-t ( 222) 692 177.5 9.1e-42 ref|XP_005811939.1| PREDICTED: glutathione S-t ( 223) 692 177.5 9.2e-42 rCG25753, isoform CRA_b [Rattus norvegicus] ( 233) 692 177.5 9.7e-42 ref|NP_001134227.1| glutathione S-transferase ( 207) 690 177.0 1.2e-41 ref|XP_004005388.1| PREDICTED: glutathione S-t ( 180) 684 175.6 2.7e-41 ref|XP_007970438.1| PREDICTED: glutathione S-t ( 184) 677 173.9 9.1e-41 ref|XP_005521969.1| PREDICTED: glutathione S-t ( 165) 675 173.5 1.1e-40 ref|XP_005002263.1| PREDICTED: glutathione S-t ( 222) 676 173.6 1.4e-40 glutathione S-transferase, alpha 4, isoform CRA_c ( 233) 676 173.6 1.5e-40 ref|XP_004599508.1| PREDICTED: glutathione S-t ( 192) 673 172.9 1.9e-40 Gsta3 protein [Rattus norvegicus] ( 153) 670 172.3 2.3e-40 ref|XP_003213792.1| PREDICTED: glutathione S-t ( 174) 668 171.7 3.9e-40 Glutathione S-transferase 3, partial [Eurypyga hel ( 185) 667 171.5 5e-40 ref|XP_006004809.1| PREDICTED: glutathione S-t ( 193) 667 171.4 5.3e-40 ref|XP_007632085.1| PREDICTED: glutathione S-t ( 177) 666 171.2 5.6e-40 ref|XP_004628380.1| PREDICTED: glutathione S-t ( 213) 667 171.4 6e-40 Glutathione S-transferase 3, partial [Gavia stella ( 183) 663 170.5 9.7e-40 ref|XP_007651981.1| PREDICTED: glutathione S-t ( 177) 660 169.8 1.5e-39 similar to class-alpha glutathione S-transferase ( ( 188) 659 169.5 2e-39 Glutathione S-transferase A2 [Tupaia chinensis] ( 145) 653 168.1 3.9e-39 ref|XP_008055890.1| PREDICTED: glutathione S-t ( 269) 654 168.1 7.4e-39 Glutathione S-transferase A2 [Tupaia chinensis] ( 142) 648 166.9 8.8e-39 hypothetical protein L345_13115, partial [Ophiopha ( 192) 647 166.5 1.6e-38 ref|XP_006884955.1| PREDICTED: glutathione S-t ( 220) 647 166.5 1.9e-38 ref|XP_006748219.1| PREDICTED: glutathione S-t ( 256) 646 166.2 2.7e-38 ref|XP_005223516.1| PREDICTED: glutathione S-t ( 208) 638 164.3 7.9e-38 ref|XP_006056839.1| PREDICTED: glutathione S-t ( 208) 638 164.3 7.9e-38 ref|XP_005223515.1| PREDICTED: glutathione S-t ( 251) 638 164.2 1e-37 Glutathione S-transferase 3, partial [Podiceps cri ( 182) 635 163.6 1.1e-37 ref|XP_008521942.1| PREDICTED: glutathione S-t ( 256) 637 164.0 1.2e-37 ref|XP_005882492.1| PREDICTED: glutathione S-t ( 138) 632 163.0 1.3e-37 ref|XP_004921465.1| PREDICTED: LOW QUALITY PRO ( 222) 634 163.3 1.7e-37 ref|XP_008690003.1| PREDICTED: glutathione S-t ( 171) 631 162.7 2e-37 ref|XP_006182442.1| PREDICTED: glutathione S-t ( 197) 631 162.6 2.4e-37 Glutathione S-transferase, partial [Pterocles gutt ( 139) 620 160.1 9.9e-37 Glutathione S-transferase, partial [Balearica pavo ( 139) 612 158.1 3.8e-36 Glutathione S-transferase Yc, partial [Balearica p ( 139) 608 157.2 7.6e-36 Glutathione S-transferase, partial [Opisthocomus h ( 139) 608 157.2 7.6e-36 ref|NP_001232690.1| putative glutathione trans ( 173) 608 157.1 1e-35 ref|XP_004555988.1| PREDICTED: glutathione S-t ( 255) 607 156.6 2e-35 ref|XP_006902881.1| PREDICTED: glutathione S-t ( 222) 595 153.8 1.3e-34 ref|XP_002590293.1| hypothetical protein BRAFL ( 220) 593 153.3 1.8e-34 ref|XP_006165777.1| PREDICTED: glutathione S-t ( 185) 591 152.9 2e-34 Glutathione S-transferase A2 [Myotis davidii] ( 154) 587 152.0 3e-34 ref|XP_003776905.1| PREDICTED: LOW QUALITY PRO ( 283) 586 151.4 8.1e-34 ref|XP_008261279.1| PREDICTED: glutathione S-t ( 185) 582 150.7 9e-34 ref|XP_002120526.1| PREDICTED: glutathione S-t ( 221) 583 150.8 9.7e-34 Serine/threonine-protein kinase ICK [Tupaia chinen ( 676) 591 152.3 1.1e-33 ref|XP_005666527.1| PREDICTED: glutathione S-t ( 232) 581 150.3 1.4e-33 ref|XP_006056840.1| PREDICTED: glutathione S-t ( 185) 578 149.7 1.8e-33 ref|XP_006219817.1| PREDICTED: glutathione S-t ( 113) 574 148.9 1.8e-33 ref|XP_006995156.1| PREDICTED: glutathione S-t ( 181) 577 149.5 2.1e-33 Glutathione S-transferase 3, partial [Cariama cris ( 139) 572 148.4 3.4e-33 ref|XP_006991770.1| PREDICTED: glutathione S-t ( 169) 570 147.8 6.1e-33 ref|XP_007657037.1| PREDICTED: glutathione S-t ( 179) 564 146.3 1.8e-32 ref|XP_008992828.1| PREDICTED: glutathione S-t ( 178) 555 144.1 8.4e-32 ref|XP_006822382.1| PREDICTED: glutathione S-t ( 225) 555 144.0 1.1e-31 ref|XP_006813791.1| PREDICTED: glutathione S-t ( 218) 551 143.0 2.2e-31 ref|XP_002604147.1| hypothetical protein BRAFL ( 220) 549 142.5 3.1e-31 Glutathione S-transferase, partial [Podiceps crist ( 138) 540 140.5 7.6e-31 ref|XP_004696616.1| PREDICTED: glutathione S-t ( 209) 542 140.8 9.4e-31 unnamed protein product [Homo sapiens] ( 166) 537 139.7 1.6e-30 Glutathione S-transferase A2, partial [Bos mutus] ( 90) 530 138.3 2.4e-30 ref|XP_003945130.1| PREDICTED: glutathione S-t ( 110) 531 138.4 2.6e-30 Glutathione S-transferase 3, partial [Fulmarus gla ( 141) 532 138.6 3e-30 ref|XP_006800790.1| PREDICTED: glutathione S-t ( 172) 533 138.7 3.3e-30 ref|XP_007934469.1| PREDICTED: glutathione S-t ( 166) 530 138.0 5.3e-30 Glutathione S-transferase alpha-3 [Cricetulus gris ( 128) 522 136.2 1.5e-29 ref|XP_005496029.1| PREDICTED: glutathione S-t ( 136) 522 136.1 1.6e-29 hypothetical protein CB1_000602007 [Camelus ferus] ( 127) 520 135.7 2e-29 glutathione S-transferase A4, isoform CRA_c, parti ( 162) 521 135.8 2.4e-29 glutathione S-transferase alpha [Mytilus galloprov ( 216) 521 135.7 3.4e-29 glutathione S-transferase A6-like protein [Cricetu ( 242) 521 135.6 4e-29 hCG1779113, partial [Homo sapiens] ( 193) 517 134.7 5.9e-29 ref|XP_003945120.1| PREDICTED: glutathione S-t ( 107) 509 133.1 1e-28 Glutathione S-transferase, partial [Pterocles gutt ( 137) 509 132.9 1.4e-28 glutathione S-transferase alpha, partial [Cirrhinu ( 135) 507 132.5 2e-28 Glutathione S-transferase A6 [Cricetulus griseus] ( 242) 511 133.2 2.2e-28 ref|XP_006996954.1| PREDICTED: glutathione S-t ( 200) 505 131.8 4.7e-28 Glutathione S-transferase alpha-5 [Cricetulus gris ( 128) 501 131.0 5.1e-28 ref|XP_005072485.1| PREDICTED: glutathione S-t ( 187) 502 131.1 7.1e-28 Unknown (protein for MGC:135745) [Xenopus (Siluran ( 189) 501 130.8 8.6e-28 ref|XP_004444057.1| PREDICTED: LOW QUALITY PRO ( 180) 495 129.4 2.2e-27 ref|XP_007238599.1| PREDICTED: glutathione S-t ( 164) 493 128.9 2.8e-27 ref|XP_006998657.1| PREDICTED: glutathione S-t ( 120) 490 128.4 3e-27 Glutathione S-transferase, partial [Colius striatu ( 124) 490 128.3 3.2e-27 ref|XP_009203656.1| PREDICTED: glutathione S-t ( 180) 490 128.2 5.2e-27 LOC446920 protein, partial [Xenopus laevis] ( 129) 487 127.6 5.6e-27 ref|XP_003513564.1| PREDICTED: glutathione S-t ( 130) 487 127.6 5.6e-27 hypothetical protein CB1_000602006 [Camelus ferus] ( 355) 494 128.8 6.5e-27 glutathione S-transferase alpha, partial [Ctenopha ( 135) 486 127.3 7e-27 ref|XP_006791942.1| PREDICTED: glutathione S-t ( 145) 480 125.8 2.1e-26 ref|XP_007632090.1| PREDICTED: glutathione S-t ( 130) 478 125.4 2.6e-26 ref|XP_008509180.1| PREDICTED: glutathione S-t ( 127) 477 125.2 3e-26 ref|XP_006995157.1| PREDICTED: glutathione S-t ( 170) 477 125.0 4.4e-26 GST-alpha [Perinereis nuntia] ( 220) 479 125.4 4.4e-26 ref|XP_002120401.2| PREDICTED: glutathione S-t ( 199) 478 125.2 4.5e-26 Glutathione S-transferase A2 [Ophiophagus hannah] ( 91) 471 123.8 5.3e-26 glutathione S-transferase alpha 4 [Mesocricetus au ( 114) 471 123.7 7.1e-26 ref|XP_006813793.1| PREDICTED: glutathione S-t ( 193) 473 124.0 1e-25 ref|XP_004466871.1| PREDICTED: glutathione S-t ( 137) 470 123.4 1.1e-25 Glutathione S-transferase 3, partial [Egretta garz ( 223) 472 123.7 1.5e-25 Glutathione S-transferase 3 [Crassostrea gigas] ( 218) 471 123.4 1.7e-25 Glutathione S-transferase [Chelonia mydas] ( 284) 473 123.8 1.7e-25 ref|XP_008509256.1| PREDICTED: glutathione S-t ( 89) 453 119.4 1.1e-24 ref|XP_006823138.1| PREDICTED: glutathione S-t ( 258) 459 120.4 1.6e-24 ref|XP_007194105.1| PREDICTED: LOW QUALITY PRO ( 175) 455 119.6 1.9e-24 ref|XP_006816610.1| PREDICTED: glutathione S-t ( 247) 456 119.7 2.5e-24 ref|XP_001515166.1| PREDICTED: glutathione S-t ( 92) 434 114.8 2.8e-23 glutathione S-transferase, alpha 4, isoform CRA_b ( 113) 434 114.7 3.7e-23 ref|XP_006024544.1| PREDICTED: glutathione S-t ( 212) 438 115.4 4.4e-23 ref|XP_001516522.1| PREDICTED: glutathione S-t ( 147) 435 114.8 4.5e-23 ref|XP_788101.1| PREDICTED: glutathione S-trans ( 227) 438 115.3 4.8e-23 ref|XP_004449937.1| PREDICTED: glutathione S-t ( 182) 436 115.0 5e-23 ref|XP_006996953.1| PREDICTED: glutathione S-t ( 134) 430 113.6 9.2e-23 ref|XP_005604131.1| PREDICTED: glutathione S-t ( 174) 432 114.0 9.3e-23 ref|XP_795748.2| PREDICTED: glutathione S-tran ( 227) 432 113.9 1.3e-22 ref|XP_004771925.1| PREDICTED: glutathione S-t ( 179) 430 113.5 1.4e-22 glutathione S-transferase [Strongylocentrotus inte ( 227) 431 113.6 1.6e-22 ref|XP_006813792.1| PREDICTED: glutathione S-t ( 182) 428 113.0 1.9e-22 putative alpha class glutathione-s-transferase [Ha ( 189) 427 112.7 2.4e-22 ref|XP_004450537.1| PREDICTED: glutathione S-t ( 84) 417 110.7 4.5e-22 ref|XP_786216.1| PREDICTED: glutathione S-trans ( 226) 421 111.2 8.5e-22 Glutathione S-transferase 3, partial [Leptosomus d ( 138) 415 109.9 1.2e-21 glutathione S-transferase A4 [Camelus ferus] ( 213) 418 110.5 1.3e-21 rCG25753, isoform CRA_a [Rattus norvegicus] ( 128) 414 109.7 1.3e-21 ref|XP_006024558.1| PREDICTED: glutathione S-t ( 189) 416 110.0 1.6e-21 ref|XP_001100434.2| PREDICTED: glutathione S-t ( 148) 413 109.4 1.9e-21 ref|XP_005896915.1| PREDICTED: glutathione S-t ( 85) 408 108.5 2.1e-21 ref|XP_009203644.1| PREDICTED: glutathione S-t ( 127) 410 108.8 2.5e-21 ref|XP_003423555.1| PREDICTED: glutathione S-t ( 85) 403 107.2 4.9e-21 ref|XP_009203643.1| PREDICTED: glutathione S-t ( 132) 406 107.8 5.3e-21 GST_alpha-like protein [Strongylocentrotus droebac ( 224) 410 108.5 5.4e-21 ref|XP_005360067.1| PREDICTED: glutathione S-t ( 225) 407 107.8 9e-21 ref|XP_008261270.1| PREDICTED: glutathione S-t ( 125) 402 106.8 9.7e-21 hCG1779112, partial [Homo sapiens] ( 127) 402 106.8 9.9e-21 ref|XP_009057066.1| hypothetical protein LOTGI ( 218) 404 107.0 1.4e-20 ref|XP_004449938.1| PREDICTED: glutathione S-t ( 200) 401 106.4 2.1e-20 ref|XP_006638913.1| PREDICTED: glutathione S-t ( 135) 377 100.7 7.4e-19 ref|XP_792223.2| PREDICTED: glutathione S-tran ( 230) 379 100.9 1.1e-18 ref|XP_009013006.1| hypothetical protein HELRO ( 221) 372 99.2 3.3e-18 ref|XP_008823450.1| PREDICTED: glutathione S-t ( 87) 364 97.7 3.8e-18 Glutathione S-transferase P [Salmo salar] ( 207) 370 98.8 4.3e-18 ref|XP_004338931.1| glutathione stransferase [ ( 219) 370 98.7 4.6e-18 ref|XP_002731488.1| PREDICTED: hematopoietic p ( 207) 369 98.5 5.1e-18 Glutathione S-transferase P [Esox lucius] ( 208) 368 98.3 6.1e-18 ref|XP_004341862.1| glutathione transferase fa ( 220) 368 98.2 6.5e-18 Glutathione S-transferase P [Esox lucius] ( 208) 365 97.5 1e-17 ref|XP_002731499.2| PREDICTED: hematopoietic p ( 224) 365 97.5 1.1e-17 hypothetical protein DAPPUDRAFT_230761 [Daphnia pu ( 204) 364 97.3 1.2e-17 Glutathione S-transferase P [Salmo salar] ( 207) 364 97.3 1.2e-17 ref|XP_003384998.1| PREDICTED: glutathione S-t ( 215) 364 97.3 1.2e-17 Glutathione S-transferase P [Salmo salar] ( 211) 363 97.0 1.4e-17 Glutathione S-transferase P [Caligus rogercresseyi ( 207) 362 96.8 1.7e-17 ref|XP_003116418.1| hypothetical protein CRE_0 ( 210) 362 96.8 1.7e-17 ref|XP_003776906.1| PREDICTED: glutathione S-t ( 103) 356 95.7 1.8e-17 GSTA4, partial [synthetic construct] ( 129) 357 95.8 2.1e-17 Glutathione S-transferase P 2 [Cricetulus griseus] ( 210) 360 96.3 2.4e-17 ref|XP_003509973.2| PREDICTED: glutathione S-t ( 222) 360 96.3 2.6e-17 glutathione S-transferase P 2-like protein [Cricet ( 225) 360 96.3 2.6e-17 sigma glutathione S-transferase 1 [Ruditapes phili ( 203) 359 96.1 2.7e-17 Glutathione S-transferase P [Salmo salar] ( 208) 359 96.1 2.8e-17 ref|XP_006629918.1| PREDICTED: glutathione S-t ( 285) 361 96.4 3e-17 hypothetical protein DAPPUDRAFT_210571 [Daphnia pu ( 210) 358 95.8 3.3e-17 unnamed protein product [Oncorhynchus mykiss] ( 241) 359 96.0 3.4e-17 Glutathione S-transferase P [Salmo salar] ( 208) 357 95.6 3.9e-17 glutathione S-transferase P [Ictalurus furcatus] ( 208) 356 95.3 4.6e-17 Glutathione S-transferase A4 [Myotis davidii] ( 129) 352 94.6 4.9e-17 glutathione S-transferase, alpha 4, isoform CRA_d ( 175) 354 94.9 5.2e-17 ref|XP_001200184.1| PREDICTED: glutathione S-t ( 200) 355 95.1 5.2e-17 Glutathione-requiring prostaglandin D synthase [Cr ( 203) 355 95.1 5.3e-17 unnamed protein product, partial [Oncorhynchus myk ( 303) 357 95.4 6.4e-17 hypothetical protein DAPPUDRAFT_316498 [Daphnia pu ( 212) 354 94.8 6.7e-17 ref|XP_005006026.1| PREDICTED: glutathione S-t ( 107) 348 93.7 7.5e-17 glutathione S-transferase pi [Perna viridis] ( 205) 353 94.6 7.6e-17 unnamed protein product [Oncorhynchus mykiss] ( 224) 353 94.6 8.5e-17 GST-pi [Perinereis nuntia] ( 199) 351 94.1 1e-16 ref|XP_005106678.1| PREDICTED: glutathione S-t ( 205) 350 93.9 1.3e-16 ref|XP_003779934.1| PREDICTED: glutathione S-t ( 84) 343 92.6 1.3e-16 ref|XP_006812411.1| PREDICTED: hematopoietic p ( 207) 350 93.9 1.3e-16 glutathione S-transferase alpha [Brachionus sp. 'k ( 173) 348 93.5 1.4e-16 ref|XP_002426887.1| glutathione S-transferase, ( 204) 349 93.6 1.5e-16 ref|XP_006926884.1| PREDICTED: glutathione S-t ( 182) 348 93.4 1.5e-16 ref|XP_002731491.1| PREDICTED: S-crystallin SL ( 207) 349 93.6 1.5e-16 Glutathione S-transferase A4 [Myotis davidii] ( 76) 341 92.1 1.6e-16 sp|P81942.1|GSTP1_BUFBU RecName: Full=Glutathio ( 210) 348 93.4 1.8e-16 ref|XP_003116700.1| hypothetical protein CRE_0 ( 203) 347 93.1 2.1e-16 ref|XP_006861119.1| PREDICTED: glutathione S-t ( 240) 348 93.3 2.2e-16 ref|XP_004394106.1| PREDICTED: glutathione S-t ( 229) 347 93.1 2.4e-16 ref|XP_009012636.1| hypothetical protein HELRO ( 207) 346 92.9 2.5e-16 ref|XP_001498156.1| PREDICTED: glutathione S-t ( 210) 346 92.9 2.6e-16 mCG1025522 [Mus musculus] ( 134) 342 92.1 2.8e-16 putative glutathione S-transferase [Polysphondyliu ( 205) 345 92.6 2.9e-16 ref|XP_001616766.1| glutathione s-transferase ( 205) 345 92.6 2.9e-16 ref|XP_008817475.1| glutathione S-transferase ( 205) 345 92.6 2.9e-16 glutathione S-transferase pi [Carassius auratus] ( 208) 345 92.6 3e-16 ref|XP_005474232.1| PREDICTED: LOW QUALITY PRO ( 224) 344 92.4 3.9e-16 ref|XP_786160.3| PREDICTED: glutathione S-tran ( 204) 343 92.2 4.1e-16 Hematopoietic prostaglandin D synthase-1 [Strongyl ( 208) 343 92.1 4.2e-16 ref|XP_006171334.1| PREDICTED: glutathione S-t ( 210) 343 92.1 4.3e-16 ref|XP_004224452.1| glutathione s-transferase ( 205) 342 91.9 4.9e-16 Glutathione S-transferase P [Tupaia chinensis] ( 235) 343 92.1 4.9e-16 ref|NP_503701.1| Protein GST-10 [Caenorhabditis ( 210) 342 91.9 5e-16 ref|XP_006743667.1| PREDICTED: glutathione S-t ( 210) 341 91.7 6e-16 ref|NP_001016641.1| glutathione S-transferase p ( 211) 341 91.6 6e-16 ref|XP_004344204.1| glutathione S-transferase, ( 219) 341 91.6 6.3e-16 putative glutathione S-transferase [Polysphondyliu ( 202) 340 91.4 6.7e-16 ref|NP_001233673.1| glutathione S-transferase ( 210) 340 91.4 7.1e-16 glutathione S-transferase P 1 [Cricetulus griseus] ( 221) 340 91.4 7.6e-16 hypothetical protein PPL_05780 [Polysphondylium pa ( 204) 339 91.2 8.1e-16 ref|XP_002113999.1| expressed hypothetical pro ( 205) 339 91.2 8.1e-16 hypothetical protein SINV_13865 [Solenopsis invict ( 207) 339 91.2 8.2e-16 pi-class glutathione S-transferase [Mytilus corusc ( 206) 338 90.9 9.7e-16 ref|XP_004991204.1| hypothetical protein PTSG_ ( 236) 339 91.1 9.8e-16 ref|XP_005099402.1| PREDICTED: glutathione S-t ( 209) 338 90.9 9.9e-16 ref|XP_006980588.1| PREDICTED: glutathione S-t ( 210) 338 90.9 9.9e-16 ref|XP_005289505.1| PREDICTED: glutathione S-t ( 211) 338 90.9 1e-15 ref|XP_005099401.1| PREDICTED: glutathione S-t ( 217) 338 90.9 1e-15 glutathione S-transferase pi [Oncorhynchus kisutch ( 208) 337 90.7 1.2e-15 ref|XP_006629919.1| PREDICTED: glutathione S-t ( 209) 337 90.7 1.2e-15 ref|NP_001239096.1| glutathione S-transferase ( 210) 337 90.7 1.2e-15 ref|XP_001348360.1| glutathione S-transferase ( 211) 337 90.7 1.2e-15 glutathione S-transferase [Plasmodium falciparum F ( 212) 337 90.7 1.2e-15 ref|XP_002930487.1| PREDICTED: LOW QUALITY PRO ( 189) 336 90.5 1.2e-15 glutathione S-transferase [Oncorhynchus nerka] ( 216) 337 90.7 1.2e-15 pdb|2AAW|A Chain A, Studies On Ligand Binding A ( 222) 337 90.6 1.3e-15 ref|XP_002260817.1| glutathione s-transferase ( 205) 336 90.4 1.4e-15 ref|XP_005351698.1| PREDICTED: glutathione S-t ( 210) 336 90.4 1.4e-15 pdb|3FR6|A Chain A, Tetramerization And Cooper ( 211) 336 90.4 1.4e-15 sp|P80031.2|GSTP1_PIG RecName: Full=Glutathione S ( 207) 335 90.2 1.6e-15 pdb|2GSR|A Chain A, Structure Of Porcine Class P ( 207) 335 90.2 1.6e-15 pdb|1LBK|A Chain A, Crystal Structure Of A Reco ( 208) 335 90.2 1.6e-15 ref|XP_007253688.1| PREDICTED: glutathione S-t ( 208) 335 90.2 1.6e-15 ref|XP_786901.2| PREDICTED: S-crystallin 4-lik ( 209) 335 90.2 1.6e-15 ref|XP_002108825.1| expressed hypothetical pro ( 202) 334 90.0 1.9e-15 ref|XP_001637222.1| predicted protein [Nematos ( 203) 334 90.0 1.9e-15 ref|XP_008191063.1| PREDICTED: glutathione S-t ( 204) 334 90.0 1.9e-15 ref|XP_002730920.1| PREDICTED: hematopoietic p ( 205) 334 90.0 1.9e-15 glutathione S-transferase GSTpi1 [Mytilus gallopro ( 206) 334 89.9 1.9e-15 ref|NP_001018349.1| glutathione S-transferase p ( 208) 334 89.9 1.9e-15 hypothetical protein DAPPUDRAFT_223594 [Daphnia pu ( 211) 334 89.9 2e-15 ref|XP_006771739.1| PREDICTED: glutathione S-t ( 212) 334 89.9 2e-15 glutathione s-transferase [Plasmodium falciparum] ( 213) 334 89.9 2e-15 sp|P47954.2|GSTP1_CRIMI RecName: Full=Glutathion ( 210) 333 89.7 2.3e-15 ref|XP_004656540.1| PREDICTED: glutathione S-t ( 239) 334 89.9 2.3e-15 ref|XP_009016114.1| hypothetical protein HELRO ( 212) 333 89.7 2.3e-15 ref|XP_004337171.1| glutathione transferase su ( 227) 333 89.7 2.6e-15 ref|XP_005660678.1| PREDICTED: glutathione S-t ( 294) 335 90.0 2.6e-15 ref|XP_005486086.1| PREDICTED: glutathione S-t ( 179) 331 89.3 2.6e-15 ref|XP_002116131.1| hypothetical protein TRIAD ( 204) 332 89.5 2.6e-15 glutathione S-transferase, putative [Plasmodium ch ( 205) 332 89.5 2.7e-15 Glutathione S-transferase P [Myotis davidii] ( 266) 334 89.8 2.7e-15 ref|XP_009012637.1| hypothetical protein HELRO ( 207) 332 89.5 2.7e-15 ref|NP_571809.1| glutathione S-transferase pi [ ( 208) 332 89.5 2.7e-15 ref|XP_003723379.1| PREDICTED: S-crystallin 4- ( 209) 332 89.5 2.7e-15 hypothetical protein D910_11645 [Dendroctonus pond ( 211) 332 89.4 2.8e-15 ref|XP_004618621.1| PREDICTED: glutathione S-t ( 247) 333 89.6 2.9e-15 ref|XP_004437888.1| PREDICTED: glutathione S-t ( 253) 333 89.6 3e-15 hypothetical protein YQE_11126, partial [Dendrocto ( 225) 332 89.4 3e-15 glutathione S-transferase [Plasmodium vinckei pett ( 205) 331 89.2 3.2e-15 ref|XP_008623959.1| glutathione S-transferase ( 205) 331 89.2 3.2e-15 hypothetical protein Y032_0110g141 [Ancylostoma ce ( 206) 331 89.2 3.2e-15 ref|XP_009006824.1| PREDICTED: glutathione S-t ( 210) 331 89.2 3.3e-15 ref|XP_003215129.1| PREDICTED: glutathione S-t ( 211) 331 89.2 3.3e-15 ref|XP_006035970.1| PREDICTED: glutathione S-t ( 298) 333 89.5 3.7e-15 ref|XP_003694332.1| PREDICTED: glutathione S-t ( 207) 330 89.0 3.8e-15 ref|XP_007126992.1| PREDICTED: glutathione S-t ( 208) 330 89.0 3.8e-15 hypothetical protein PANDA_010232 [Ailuropoda mela ( 210) 330 89.0 3.9e-15 ref|XP_002921331.1| PREDICTED: glutathione S-t ( 210) 330 89.0 3.9e-15 ref|XP_006230798.1| PREDICTED: uncharacterized ( 210) 330 89.0 3.9e-15 ref|NP_001268775.1| glutathione S-transferase ( 210) 330 89.0 3.9e-15 ref|XP_005706455.1| glutathione S-transferase ( 214) 330 89.0 4e-15 ref|XP_004278172.1| PREDICTED: glutathione S-t ( 282) 332 89.3 4.1e-15 Glutathione S-transferase [Zootermopsis nevadensis ( 204) 329 88.7 4.4e-15 pdb|3FR3|A Chain A, Tetramerization And Cooper ( 208) 329 88.7 4.5e-15 ref|XP_007126991.1| PREDICTED: glutathione S-t ( 237) 330 88.9 4.5e-15 ref|XP_005003086.1| PREDICTED: glutathione S-t ( 210) 329 88.7 4.6e-15 hypothetical protein PPL_09155 [Polysphondylium pa ( 202) 328 88.5 5.1e-15 ref|XP_006171330.1| PREDICTED: glutathione S-t ( 210) 328 88.5 5.4e-15 ref|NP_659118.1| glutathione S-transferase P-li ( 210) 328 88.5 5.4e-15 glutathione-S-transferase Pi [Triaenodon obesus] ( 210) 328 88.5 5.4e-15 glutathione s-transferase [Ascaris suum] ( 210) 328 88.5 5.4e-15 ref|XP_005598404.1| PREDICTED: glutathione S-t ( 210) 328 88.5 5.4e-15 ref|XP_008508617.1| PREDICTED: glutathione S-t ( 212) 328 88.5 5.5e-15 ref|XP_005352030.1| PREDICTED: glutathione S-t ( 213) 328 88.5 5.5e-15 Glutathione S-transferase P [Tupaia chinensis] ( 215) 328 88.5 5.6e-15 glutathione S-transferase P-like protein [Camelus ( 216) 328 88.5 5.6e-15 ref|XP_006176059.1| PREDICTED: glutathione S-t ( 217) 328 88.5 5.7e-15 ref|XP_005864549.1| PREDICTED: glutathione S-t ( 252) 329 88.6 5.8e-15 ref|XP_004713779.1| PREDICTED: glutathione S-t ( 224) 328 88.4 5.9e-15 ref|XP_004598309.1| PREDICTED: glutathione S-t ( 293) 330 88.8 6e-15 ref|XP_004360322.1| putative glutathione S-tra ( 200) 327 88.2 6e-15 ref|XP_003214163.1| PREDICTED: glutathione S-t ( 83) 320 86.9 6.2e-15 ref|XP_007518849.1| PREDICTED: glutathione S-t ( 341) 331 89.0 6.2e-15 ref|XP_006980587.1| PREDICTED: glutathione S-t ( 210) 327 88.2 6.4e-15 ref|XP_005343899.1| PREDICTED: glutathione S-t ( 210) 327 88.2 6.4e-15 ref|XP_006102551.1| PREDICTED: glutathione S-t ( 210) 327 88.2 6.4e-15 glutathione S-transferase, putative [Plasmodium yo ( 205) 326 88.0 7.4e-15 glutathione S-transferase, putative [Plasmodium be ( 205) 326 88.0 7.4e-15 glutahione S-transferase pi [synthetic construct] ( 208) 326 88.0 7.5e-15 ref|NP_036709.1| glutathione S-transferase P [R ( 210) 326 88.0 7.6e-15 ref|XP_002636047.1| C. briggsae CBR-GST-10.2 p ( 210) 326 88.0 7.6e-15 ref|NP_504894.1| Protein GST-41 [Caenorhabditis ( 210) 326 88.0 7.6e-15 ref|XP_004656539.1| PREDICTED: glutathione S-t ( 243) 327 88.2 7.8e-15 ref|XP_006176060.1| PREDICTED: glutathione S-t ( 226) 326 87.9 8.4e-15 ref|XP_003468154.2| PREDICTED: glutathione S-t ( 340) 329 88.5 8.6e-15 ref|XP_002731492.1| PREDICTED: S-crystallin SL ( 206) 325 87.7 8.8e-15 Pi-class glutathione S-transferase [Cyprinus carpi ( 208) 325 87.7 8.9e-15 ref|XP_007943130.1| PREDICTED: uncharacterized ( 450) 331 88.9 8.9e-15 ref|NP_001127471.1| glutathione S-transferase ( 210) 325 87.7 9e-15 Glutathione S-transferase-like protein [Camelus fe ( 250) 326 87.9 9.6e-15 ref|XP_004319239.1| PREDICTED: glutathione S-t ( 288) 327 88.1 9.7e-15 hCG1789632, partial [Homo sapiens] ( 176) 323 87.3 1e-14 sigma class glutathione S-transferase [Hyriopsis c ( 203) 324 87.5 1e-14 glutathione S-transferase [Haemonchus contortus] ( 205) 324 87.5 1e-14 ref|XP_004627398.1| PREDICTED: glutathione S-t ( 302) 327 88.1 1e-14 glutathione S-transferase pi [Mytilus edulis] ( 206) 324 87.5 1e-14 ref|XP_006893465.1| PREDICTED: glutathione S-t ( 236) 325 87.7 1e-14 Pi-class glutathione S-transferase [Cyprinus carpi ( 208) 324 87.5 1.1e-14 pi-class glutathione S-transferase [Gobio gobio] ( 208) 324 87.5 1.1e-14 ref|XP_006210822.1| PREDICTED: glutathione S-t ( 287) 326 87.8 1.1e-14 hypothetical protein PPL_10596 [Polysphondylium pa ( 199) 323 87.3 1.2e-14 ref|XP_003798441.1| PREDICTED: glutathione S-t ( 299) 326 87.8 1.2e-14 ref|XP_005104780.1| PREDICTED: probable glutat ( 206) 323 87.3 1.2e-14 ref|XP_003798440.1| PREDICTED: uncharacterized ( 445) 329 88.4 1.2e-14 ref|XP_005090420.1| PREDICTED: S-crystallin SL ( 207) 323 87.3 1.2e-14 ref|XP_005631454.1| PREDICTED: glutathione S-t ( 210) 323 87.2 1.3e-14 ref|NP_001082252.1| glutathione S-transferase ( 212) 323 87.2 1.3e-14 ref|XP_004713778.1| PREDICTED: glutathione S-t ( 213) 323 87.2 1.3e-14 ref|XP_004344122.1| glutathione transferase fa ( 218) 323 87.2 1.3e-14 ref|XP_004344207.1| glutathione transferase fa ( 323) 326 87.8 1.3e-14 hypothetical protein PPL_05344 [Polysphondylium pa ( 203) 322 87.0 1.4e-14 ref|XP_003492443.1| PREDICTED: glutathione S-t ( 206) 322 87.0 1.5e-14 pdb|3HJM|A Chain A, Crystal Structure Of Human ( 209) 322 87.0 1.5e-14 Glutathione S-transferase P, partial [Bos mutus] ( 210) 322 87.0 1.5e-14 ref|NP_803482.1| glutathione S-transferase P [B ( 210) 322 87.0 1.5e-14 ref|XP_004917627.1| PREDICTED: glutathione S-t ( 211) 322 87.0 1.5e-14 ref|XP_007127019.1| PREDICTED: glutathione S-t ( 276) 324 87.4 1.5e-14 ref|XP_006911075.1| PREDICTED: glutathione S-t ( 193) 321 86.8 1.6e-14 ref|XP_006812416.1| PREDICTED: hematopoietic p ( 298) 324 87.3 1.7e-14 ref|XP_002112174.1| expressed hypothetical pro ( 205) 321 86.8 1.7e-14 hypothetical protein CAPTEDRAFT_113596 [Capitella ( 208) 321 86.8 1.8e-14 pdb|3KM6|A Chain A, Crystal Structure Of The H ( 209) 321 86.8 1.8e-14 ref|XP_005365457.1| PREDICTED: glutathione S-t ( 210) 321 86.8 1.8e-14 ref|XP_005333392.1| PREDICTED: glutathione S-t ( 210) 321 86.8 1.8e-14 pdb|22GS|A Chain A, Human Glutathione S-Transfer ( 210) 321 86.8 1.8e-14 ref|XP_005704516.1| glutathione S-transferase ( 212) 321 86.8 1.8e-14 pi-glutathione S-transferase [Cristaria plicata] ( 205) 320 86.5 2e-14 ref|XP_008145247.1| PREDICTED: glutathione S-t ( 244) 321 86.7 2.2e-14 CBN-GST-40 protein [Caenorhabditis brenneri] ( 215) 320 86.5 2.2e-14 ref|XP_004437889.1| PREDICTED: glutathione S-t ( 369) 324 87.2 2.2e-14 ref|XP_005903646.1| PREDICTED: glutathione S-t ( 300) 322 86.8 2.4e-14 Glutathione S-transferase domain containing protei ( 205) 319 86.3 2.4e-14 ref|XP_003703955.1| PREDICTED: glutathione S-t ( 207) 319 86.3 2.4e-14 ref|XP_792476.3| PREDICTED: glutathione S-tran ( 211) 319 86.3 2.5e-14 hypothetical protein L345_04436 [Ophiophagus hanna ( 211) 319 86.3 2.5e-14 ref|XP_854117.1| PREDICTED: glutathione S-trans ( 318) 322 86.8 2.6e-14 ref|XP_002114318.1| hypothetical protein TRIAD ( 204) 318 86.0 2.8e-14 cytosolic glutathione S-transferase 2B [Oesophagos ( 207) 318 86.0 2.9e-14 Pi-class glutathione S-trasferase [Anguilla anguil ( 208) 318 86.0 2.9e-14 ref|XP_001603942.1| PREDICTED: glutathione S-t ( 208) 318 86.0 2.9e-14 pdb|1GTI|A Chain A, Modified Glutathione S-Trans ( 209) 318 86.0 2.9e-14 pdb|2OA7|A Chain A, Mouse C14a Glutathione-s-t ( 209) 318 86.0 2.9e-14 pdb|2J9H|A Chain A, Crystal Structure Of Human ( 209) 318 86.0 2.9e-14 pdb|4GSS|A Chain A, Human Glutathione S-Transfer ( 209) 318 86.0 2.9e-14 pdb|3O76|A Chain A, 1.8 Angstroms Molecular St ( 209) 318 86.0 2.9e-14 ref|XP_007171322.1| PREDICTED: glutathione S-t ( 210) 318 86.0 2.9e-14 ref|XP_004759594.1| PREDICTED: glutathione S-t ( 210) 318 86.0 2.9e-14 pdb|4PGT|A Chain A, Crystal Structure Of Hgstp1- ( 210) 318 86.0 2.9e-14 pdb|17GS|A Chain A, Glutathione S-Transferase P1 ( 210) 318 86.0 2.9e-14 glutathione S-transferase pi [synthetic construct] ( 211) 318 86.0 3e-14 Unknown (protein for MGC:114795) [Xenopus laevis] ( 212) 318 86.0 3e-14 ref|XP_005704507.1| glutathione S-transferase ( 216) 318 86.0 3.1e-14 ref|XP_004394107.1| PREDICTED: glutathione S-t ( 228) 318 86.0 3.3e-14 Glutathione S-transferase [Acromyrmex echinatior] ( 207) 317 85.8 3.4e-14 sp|P46426.1|GSTP_DIRIM RecName: Full=Glutathione ( 208) 317 85.8 3.4e-14 pdb|1GLP|A Chain A, 1.8 Angstroms Molecular Struc ( 209) 317 85.8 3.5e-14 pdb|1GSS|A Chain A, Three-Dimensional Structure O ( 209) 317 85.8 3.5e-14 pdb|2OAD|A Chain A, Structure Of Glutathione-S ( 209) 317 85.8 3.5e-14 glutathione s-transferase 2 [Ascaris suum] ( 209) 317 85.8 3.5e-14 Glutathione S-transferase P, partial [Macaca fasci ( 210) 317 85.8 3.5e-14 ref|XP_007962665.1| PREDICTED: glutathione S-t ( 210) 317 85.8 3.5e-14 ref|XP_004481670.1| PREDICTED: glutathione S-t ( 210) 317 85.8 3.5e-14 ref|NP_038569.1| glutathione S-transferase P 1 ( 210) 317 85.8 3.5e-14 ref|NP_001036141.1| glutathione S-transferase ( 210) 317 85.8 3.5e-14 ref|XP_003909509.1| PREDICTED: glutathione S-t ( 210) 317 85.8 3.5e-14 ref|NP_000843.1| glutathione S-transferase P [Ho ( 210) 317 85.8 3.5e-14 glutathione S-transferase pi [synthetic construct] ( 211) 317 85.8 3.5e-14 hypothetical protein PPL_09201 [Polysphondylium pa ( 202) 316 85.6 3.9e-14 ref|XP_002111650.1| expressed hypothetical pro ( 205) 316 85.5 4e-14 hypothetical protein Y032_0110g146 [Ancylostoma ce ( 207) 316 85.5 4.1e-14 ref|XP_003395155.1| PREDICTED: glutathione S-t ( 207) 316 85.5 4.1e-14 ref|XP_007962607.1| PREDICTED: glutathione S-t ( 238) 317 85.7 4.1e-14 ref|XP_004051701.1| PREDICTED: glutathione S-t ( 210) 316 85.5 4.1e-14 ref|XP_001152516.2| PREDICTED: glutathione S-t ( 210) 316 85.5 4.1e-14 Glutathione S-transferase P 1 [Fukomys damarensis] ( 311) 319 86.1 4.2e-14 ref|NP_001257315.1| uncharacterized protein LO ( 114) 311 84.6 4.3e-14 glutathione S-transferase sigma 3 [Mytilus gallopr ( 203) 315 85.3 4.7e-14 ref|XP_007518850.1| PREDICTED: glutathione S-t ( 234) 316 85.5 4.8e-14 CBN-GST-8 protein [Caenorhabditis brenneri] ( 206) 315 85.3 4.8e-14 pdb|1EOG|A Chain A, Crystal Structure Of Pi Cla ( 208) 315 85.3 4.8e-14 glutathione-S-tranferase [synthetic construct] ( 208) 315 85.3 4.8e-14 ref|XP_007171144.1| PREDICTED: glutathione S-t ( 208) 315 85.3 4.8e-14 ref|XP_004899184.1| PREDICTED: LOW QUALITY PRO ( 210) 315 85.3 4.9e-14 glutathione S-transferase [Homo sapiens] ( 210) 315 85.3 4.9e-14 ref|XP_007439250.1| PREDICTED: glutathione S-t ( 211) 315 85.3 4.9e-14 ref|XP_004366337.1| putative glutathione S-tra ( 200) 314 85.1 5.4e-14 ref|XP_004366320.1| putative glutathione S-tra ( 200) 314 85.1 5.4e-14 Glutathione S-transferase domain containing protei ( 205) 314 85.1 5.6e-14 ref|XP_001630671.1| predicted protein [Nematos ( 205) 314 85.1 5.6e-14 ref|XP_002731486.1| PREDICTED: S-crystallin 4- ( 207) 314 85.1 5.7e-14 glutathione-s-transferase pi class [Wuchereria ban ( 208) 314 85.1 5.7e-14 ref|XP_001898233.1| glutathione transferase [B ( 208) 314 85.1 5.7e-14 glutathione S-transferase Pi [Capra hircus] ( 209) 314 85.0 5.8e-14 pdb|3IE3|A Chain A, Structural Basis For The B ( 209) 314 85.0 5.8e-14 pdb|3CSI|A Chain A, Crystal Structure Of The G ( 209) 314 85.0 5.8e-14 sp|Q9TTY8.2|GSTP1_CAPHI RecName: Full=Glutathio ( 210) 314 85.0 5.8e-14 ref|XP_005384365.1| PREDICTED: glutathione S-t ( 210) 314 85.0 5.8e-14 glutathione S-transferase P1c [Homo sapiens] ( 210) 314 85.0 5.8e-14 ref|XP_797058.2| PREDICTED: glutathione S-tran ( 211) 314 85.0 5.8e-14 ref|XP_006937678.1| PREDICTED: glutathione S-t ( 362) 318 85.8 6.1e-14 Glutathione S-transferase domain containing protei ( 205) 313 84.8 6.7e-14 pdb|1KBN|A Chain A, Glutathione Transferase Mut ( 209) 313 84.8 6.8e-14 ref|XP_006072786.1| PREDICTED: glutathione S-t ( 210) 313 84.8 6.9e-14 ref|XP_002636049.1| Hypothetical protein CBG01 ( 218) 313 84.8 7.2e-14 Glutathione S-transferase P [Salmo salar] ( 192) 312 84.6 7.2e-14 Glutathione S-transferase domain containing protei ( 219) 313 84.8 7.3e-14 ref|XP_006072798.1| PREDICTED: glutathione S-t ( 254) 314 85.0 7.5e-14 ref|XP_006743689.1| PREDICTED: glutathione S-t ( 254) 314 85.0 7.5e-14 ref|XP_004337113.1| glutathione transferase su ( 228) 313 84.8 7.7e-14 ref|XP_005343860.1| PREDICTED: glutathione S-t ( 381) 317 85.5 7.7e-14 pi-class glutathione S-transferase [Cipangopaludin ( 207) 312 84.6 8e-14 unknown [Dendroctonus ponderosae] ( 207) 312 84.6 8e-14 hypothetical protein CAEBREN_25113 [Caenorhabditis ( 210) 312 84.6 8.2e-14 ref|XP_002634460.1| C. briggsae CBR-GST-40 pro ( 216) 312 84.5 8.5e-14 Glutathione S-transferase domain containing protei ( 205) 311 84.3 9.4e-14 Glutathione S-transferase [Harpegnathos saltator] ( 207) 311 84.3 9.5e-14 glutathione-s-transferase pi class [Wuchereria ban ( 208) 311 84.3 9.5e-14 ref|XP_007450482.1| PREDICTED: glutathione S-t ( 237) 312 84.5 9.6e-14 ref|XP_004383950.1| PREDICTED: glutathione S-t ( 237) 312 84.5 9.6e-14 pdb|1PX7|A Chain A, A Folding Mutant Of Human C ( 209) 311 84.3 9.6e-14 pdb|1PX6|A Chain A, A Folding Mutant Of Human C ( 209) 311 84.3 9.6e-14 ref|XP_004852278.1| PREDICTED: glutathione S-t ( 398) 316 85.2 9.6e-14 ref|XP_003941239.1| PREDICTED: glutathione S-t ( 210) 311 84.3 9.7e-14 ref|XP_002724318.1| PREDICTED: glutathione S-t ( 210) 311 84.3 9.7e-14 ref|XP_004278173.1| PREDICTED: glutathione S-t ( 245) 312 84.5 1e-13 ref|XP_007450517.1| PREDICTED: glutathione S-t ( 282) 313 84.7 1e-13 ref|XP_004759771.1| PREDICTED: glutathione S-t ( 261) 312 84.5 1.1e-13 pdb|2WS2|A Chain A, The 2 Angstrom Structure O ( 204) 310 84.1 1.1e-13 hypothetical protein RFI_08700 [Reticulomyxa filos ( 343) 314 84.8 1.1e-13 ref|XP_009207101.1| PREDICTED: LOW QUALITY PRO ( 210) 310 84.1 1.1e-13 ref|XP_008821128.1| PREDICTED: glutathione S-t ( 210) 310 84.1 1.1e-13 ref|XP_002636048.1| C. briggsae CBR-GST-10.1 p ( 210) 310 84.1 1.1e-13 mu class glutathione S-transferase [Ruditapes phil ( 217) 310 84.1 1.2e-13 ref|XP_004350195.1| hypothetical protein DFA_1 ( 198) 309 83.9 1.3e-13 ref|XP_004683373.1| PREDICTED: glutathione S-t ( 292) 312 84.4 1.3e-13 unnamed protein product [Mus musculus] ( 202) 309 83.8 1.3e-13 hypothetical protein CAPTEDRAFT_177140 [Capitella ( 205) 309 83.8 1.3e-13 pdb|1MD3|A Chain A, A Folding Mutant Of Human C ( 209) 309 83.8 1.3e-13 ref|XP_006861120.1| PREDICTED: glutathione S-t ( 216) 309 83.8 1.4e-13 ref|XP_004808691.1| PREDICTED: glutathione S-t ( 318) 312 84.4 1.4e-13 ref|XP_008580126.1| PREDICTED: glutathione S-t ( 193) 308 83.6 1.4e-13 ref|XP_004019771.1| PREDICTED: LOW QUALITY PRO ( 203) 308 83.6 1.5e-13 glutathione S-transferase [Ancylostoma caninum] ( 207) 308 83.6 1.6e-13 glutathione-S-transferase isoform [Haliotis divers ( 215) 308 83.6 1.7e-13 ref|XP_008758322.1| PREDICTED: uncharacterized ( 217) 308 83.6 1.7e-13 hypothetical protein PPL_12337 [Polysphondylium pa ( 938) 319 85.6 1.8e-13 glutathione S-transferase family member gst-3 [Bra ( 207) 307 83.3 1.9e-13 pdb|1EOH|A Chain A, Glutathione Transferase P1- ( 209) 307 83.3 1.9e-13 hypothetical protein M91_14041, partial [Bos mutus ( 210) 307 83.3 1.9e-13 ref|XP_001478705.1| PREDICTED: glutathione S-t ( 210) 307 83.3 1.9e-13 ref|XP_604297.4| PREDICTED: glutathione S-tran ( 210) 307 83.3 1.9e-13 ref|XP_006893466.1| PREDICTED: glutathione S-t ( 212) 307 83.3 1.9e-13 ref|XP_005106677.1| PREDICTED: S-crystallin SL ( 214) 307 83.3 2e-13 TPA: glutathione S-transferase, pi 1-like [Bos tau ( 231) 307 83.3 2.2e-13 ref|XP_006619664.1| PREDICTED: glutathione S-t ( 207) 306 83.1 2.2e-13 hypothetical protein Y032_0110g150 [Ancylostoma ce ( 236) 307 83.3 2.2e-13 glutathione-S-tranferase [synthetic construct] ( 208) 306 83.1 2.2e-13 hypothetical protein CAPTEDRAFT_21967 [Capitella t ( 210) 306 83.1 2.3e-13 GST_pi-like protein [Strongylocentrotus droebachie ( 210) 306 83.1 2.3e-13 ref|XP_002921332.1| PREDICTED: glutathione S-t ( 210) 306 83.1 2.3e-13 hypothetical protein Y032_0110g150 [Ancylostoma ce ( 254) 307 83.2 2.4e-13 glutathione S-transferase pi-class [Unio tumidus] ( 205) 305 82.9 2.6e-13 ref|XP_005063378.1| PREDICTED: glutathione S-t ( 207) 305 82.9 2.6e-13 hypothetical protein Y032_0110g144 [Ancylostoma ce ( 207) 305 82.9 2.6e-13 glutathione-s-transferase pi class [Wuchereria ban ( 208) 305 82.8 2.6e-13 glutathione S-transferase pi [Hypophthalmichthys n ( 208) 305 82.8 2.6e-13 ref|XP_005903645.1| PREDICTED: glutathione S-t ( 270) 307 83.2 2.7e-13 pdb|1MD4|A Chain A, A Folding Mutant Of Human C ( 209) 305 82.8 2.7e-13 ref|XP_793826.1| PREDICTED: S-crystallin SL11-l ( 210) 305 82.8 2.7e-13 ref|NP_001037833.1| prostaglandin D synthase-l ( 197) 304 82.6 2.9e-13 hypothetical protein Y032_0110g144 [Ancylostoma ce ( 228) 305 82.8 3e-13 ref|XP_006531787.1| PREDICTED: cDNA sequence B ( 260) 306 83.0 3e-13 hypothetical protein Y032_0110g144 [Ancylostoma ce ( 230) 305 82.8 3e-13 Glutathione S-transferase domain containing protei ( 205) 304 82.6 3.1e-13 glutathione S-transferase 1 [Ancylostoma duodenale ( 207) 304 82.6 3.1e-13 ref|XP_006825036.1| PREDICTED: hematopoietic p ( 188) 303 82.4 3.2e-13 ref|NP_001037828.1| prostaglandin D synthase-l ( 197) 303 82.4 3.4e-13 ref|XP_002128190.1| PREDICTED: hematopoietic p ( 199) 303 82.4 3.5e-13 glutathione-S-transferase [Sepiella maindroni] ( 204) 303 82.4 3.6e-13 Glutathione S-transferase [Camponotus floridanus] ( 207) 303 82.4 3.7e-13 hypothetical protein Y032_0110g159 [Ancylostoma ce ( 208) 303 82.4 3.7e-13 sp|P46427.1|GSTP_ONCVO RecName: Full=Glutathione ( 208) 303 82.4 3.7e-13 ref|XP_002402685.1| glutathione S-transferase, ( 220) 303 82.3 4e-13 pdb|1GSQ|A Chain A, Three-Dimensional Structur ( 202) 302 82.1 4.2e-13 sp|P46088.1|GST_OMMSL RecName: Full=Glutathione ( 203) 302 82.1 4.3e-13 ref|XP_004618620.1| PREDICTED: glutathione S-t ( 270) 304 82.5 4.4e-13 ref|NP_861461.1| glutathione S-transferase P 2 ( 210) 302 82.1 4.4e-13 ref|XP_001625867.1| predicted protein [Nematos ( 217) 302 82.1 4.6e-13 glutathione S-transferase P 1 [Cricetulus griseus] ( 193) 301 81.9 4.7e-13 ref|XP_006262487.1| PREDICTED: glutathione S-t ( 152) 299 81.5 4.8e-13 ref|XP_009049471.1| hypothetical protein LOTGI ( 197) 301 81.9 4.8e-13 ref|NP_001165918.1| glutathione S-transferase ( 203) 301 81.9 5e-13 glutathione S-transferase sigma [Tenebrio molitor] ( 204) 301 81.9 5.1e-13 hypothetical protein Y032_0110g158 [Ancylostoma ce ( 234) 302 82.1 5.1e-13 hypothetical protein PANDA_010231 [Ailuropoda mela ( 206) 301 81.9 5.1e-13 ref|XP_004481669.1| PREDICTED: glutathione S-t ( 210) 301 81.9 5.3e-13 prostaglandin D synthase-like isoform 1 [Ciona int ( 197) 300 81.7 5.7e-13 hypothetical protein Y032_0110g158 [Ancylostoma ce ( 255) 302 82.0 5.7e-13 glutathione S-transferase protein [Necator america ( 231) 301 81.8 6e-13 ref|XP_002111648.1| hypothetical protein TRIAD ( 206) 300 81.6 6.1e-13 ref|XP_002731490.1| PREDICTED: S-crystallin SL ( 207) 300 81.6 6.1e-13 hypothetical protein Y032_0007g3396 [Ancylostoma c ( 214) 300 81.6 6.4e-13 hypothetical protein Y032_0110g158 [Ancylostoma ce ( 277) 302 82.0 6.4e-13 glutathione S-transferase [Folsomia candida] ( 219) 300 81.6 6.6e-13 ref|XP_009066761.1| hypothetical protein LOTGI ( 199) 299 81.4 6.9e-13 ref|XP_004334527.1| glutathione stransferase p ( 205) 299 81.4 7.2e-13 ref|XP_725489.1| glutathione S-transferase [Pla ( 209) 299 81.4 7.3e-13 ref|XP_002672204.1| predicted protein [Naegler ( 240) 300 81.6 7.4e-13 ref|XP_791441.2| PREDICTED: S-crystallin SL11- ( 213) 299 81.4 7.5e-13 glutathione s-transferase [Stylonychia lemnae] ( 214) 299 81.4 7.6e-13 ref|XP_005631097.1| PREDICTED: glutathione S-t ( 193) 298 81.2 7.8e-13 ref|XP_006980589.1| PREDICTED: glutathione S-t ( 193) 298 81.2 7.8e-13 ref|XP_002733918.1| PREDICTED: probable glutat ( 228) 299 81.3 8.2e-13 ref|XP_003694330.1| PREDICTED: glutathione S-t ( 202) 298 81.2 8.3e-13 ref|XP_002116259.1| hypothetical protein TRIAD ( 204) 298 81.1 8.4e-13 ref|XP_002111651.1| expressed hypothetical pro ( 205) 298 81.1 8.5e-13 hypothetical protein Y032_0110g143 [Ancylostoma ce ( 206) 298 81.1 8.5e-13 ref|XP_002630603.1| Hypothetical protein CBG02 ( 206) 298 81.1 8.5e-13 glutathione transferase [Onchocerca volvulus] ( 208) 298 81.1 8.6e-13 pdb|1TU7|A Chain A, Structure Of Onchocerca Vol ( 208) 298 81.1 8.6e-13 ref|XP_002158301.1| PREDICTED: glutathione S-t ( 210) 298 81.1 8.8e-13 ref|XP_003419442.1| PREDICTED: glutathione S-t ( 412) 303 82.0 9.1e-13 ref|XP_006230799.1| PREDICTED: uncharacterized ( 193) 297 80.9 9.3e-13 glutathione S-transferase Pi class [Camelus dromed ( 195) 297 80.9 9.4e-13 ref|XP_002410641.1| glutathione S-transferase, ( 225) 298 81.1 9.6e-13 ref|XP_002114317.1| hypothetical protein TRIAD ( 201) 297 80.9 9.8e-13 ref|XP_002426889.1| glutathione S-transferase, ( 204) 297 80.9 1e-12 hypothetical protein CAEBREN_20327 [Caenorhabditis ( 205) 297 80.9 1e-12 hypothetical protein Y032_0110g149 [Ancylostoma ce ( 207) 297 80.9 1e-12 ref|XP_002162206.1| PREDICTED: S-crystallin 1- ( 210) 297 80.9 1e-12 glutathione S-transferase S1 [Laodelphax striatell ( 212) 297 80.9 1.1e-12 ref|XP_005660679.1| PREDICTED: glutathione S-t ( 191) 296 80.7 1.1e-12 hypothetical protein PPL_03058 [Polysphondylium pa ( 199) 296 80.7 1.1e-12 ref|XP_002941992.2| PREDICTED: glutathione S-t ( 230) 297 80.8 1.2e-12 glutathione S transferase mu 2 [Hymenolepis micros ( 219) 296 80.6 1.3e-12 glutathione S-transferase GSTP1-1 [Bufo bufo] ( 197) 295 80.4 1.3e-12 ref|XP_002119784.1| PREDICTED: glutathione S-t ( 139) 292 79.9 1.4e-12 hypothetical protein CAPTEDRAFT_177145 [Capitella ( 205) 295 80.4 1.4e-12 hypothetical protein Y032_0110g152 [Ancylostoma ce ( 206) 295 80.4 1.4e-12 ref|NP_494883.1| Protein GST-7 [Caenorhabditis ( 206) 295 80.4 1.4e-12 ref|XP_005706779.1| glutathione S-transferase ( 210) 295 80.4 1.5e-12 ref|XP_004852687.1| PREDICTED: glutathione S-t ( 216) 295 80.4 1.5e-12 ref|XP_008550325.1| PREDICTED: glutathione S-t ( 203) 294 80.2 1.7e-12 pdb|2ON7|A Chain A, Structure Of Nagst-1 gi|15 ( 206) 294 80.2 1.7e-12 ref|XP_002111649.1| expressed hypothetical pro ( 208) 294 80.2 1.7e-12 glutathione S-transferase [Tanichthys albonubes] ( 161) 292 79.8 1.7e-12 ref|XP_002155992.2| PREDICTED: glutathione S-t ( 210) 294 80.2 1.7e-12 ref|XP_009058861.1| hypothetical protein LOTGI ( 215) 294 80.1 1.8e-12 Glutathione S-transferase Mu 1, partial [Stegodyph ( 219) 294 80.1 1.8e-12 putative glutathione S-transferase [Folsomia candi ( 219) 294 80.1 1.8e-12 hypothetical protein DAPPUDRAFT_219658 [Daphnia pu ( 204) 293 79.9 2e-12 glutathione S-transferase pi-class [Azumapecten fa ( 205) 293 79.9 2e-12 GST_mu-like protein [Strongylocentrotus droebachie ( 207) 293 79.9 2e-12 ref|XP_002631504.1| Hypothetical protein CBG20 ( 209) 293 79.9 2e-12 hypothetical protein OXYTRI_09338 [Oxytricha trifa ( 210) 293 79.9 2e-12 Glutathione S-transferase P 1 [Crassostrea gigas] ( 213) 293 79.9 2.1e-12 glutathione transferase mu class Dp7002H05 [Dermat ( 217) 293 79.9 2.1e-12 Glutathione S-transferase Mu 1, partial [Stegodyph ( 220) 293 79.9 2.2e-12 sigma class glutathione-s-transferase [Haliotis di ( 201) 292 79.7 2.3e-12 ref|NP_001165921.1| glutathione S-transferase ( 202) 292 79.7 2.3e-12 glutathione S-transferase sigma 1 [Cnaphalocrocis ( 203) 292 79.7 2.3e-12 Glutathione S-transferase domain containing protei ( 205) 292 79.7 2.3e-12 glutathione S-transferase Pi-1 [Mercenaria mercena ( 207) 292 79.7 2.4e-12 ref|XP_002118595.1| hypothetical protein TRIAD ( 208) 292 79.7 2.4e-12 ref|XP_008550267.1| PREDICTED: glutathione S-t ( 208) 292 79.7 2.4e-12 ref|NP_506983.1| Protein GST-38 [Caenorhabditis ( 209) 292 79.7 2.4e-12 ref|XP_003108807.1| hypothetical protein CRE_1 ( 209) 292 79.7 2.4e-12 hypothetical protein CAEBREN_13249 [Caenorhabditis ( 214) 292 79.7 2.5e-12 ref|XP_006825915.1| PREDICTED: LOW QUALITY PRO ( 216) 292 79.7 2.5e-12 glutathione S-transferase mu3, partial [Paracyclop ( 217) 292 79.7 2.5e-12 ref|XP_008206156.1| PREDICTED: glutathione S-t ( 231) 292 79.6 2.7e-12 ref|XP_003694329.1| PREDICTED: glutathione S-t ( 204) 291 79.4 2.8e-12 Glutathione S-transferase [Zootermopsis nevadensis ( 204) 291 79.4 2.8e-12 mu class glutathione-s-transferase [Haliotis discu ( 215) 291 79.4 3e-12 ref|XP_003088506.1| CRE-GST-40 protein [Caenor ( 216) 291 79.4 3e-12 unknown [Dendroctonus ponderosae] ( 199) 290 79.2 3.2e-12 hypothetical protein CAEBREN_14088 [Caenorhabditis ( 205) 290 79.2 3.3e-12 ref|XP_007943131.1| PREDICTED: glutathione S-t ( 206) 290 79.2 3.3e-12 ref|XP_004342273.1| glutathione Stransferase, ( 507) 297 80.5 3.3e-12 ref|XP_003215042.2| PREDICTED: glutathione S-t ( 207) 290 79.2 3.3e-12 ref|XP_002111323.1| expressed hypothetical pro ( 208) 290 79.2 3.4e-12 ref|XP_002161231.2| PREDICTED: glutathione S-t ( 208) 290 79.2 3.4e-12 sp|P83325.1|GSTP2_BUFBU RecName: Full=Glutathio ( 210) 290 79.2 3.4e-12 hypothetical protein CAEBREN_24163 [Caenorhabditis ( 214) 290 79.2 3.5e-12 ref|XP_001699266.1| glutathione S-transferase ( 217) 290 79.2 3.6e-12 glutathione S-transferase [Sarcoptes scabiei type ( 219) 290 79.2 3.6e-12 ref|XP_002128278.1| PREDICTED: glutathione S-t ( 199) 289 79.0 3.8e-12 pdb|3W8S|A Chain A, Crystal Structure Of Monom ( 206) 289 78.9 3.9e-12 ref|XP_006531788.1| PREDICTED: cDNA sequence B ( 193) 288 78.7 4.3e-12 ref|XP_004852276.1| PREDICTED: glutathione S-t ( 489) 295 80.0 4.4e-12 ref|XP_003703954.1| PREDICTED: glutathione S-t ( 202) 288 78.7 4.5e-12 hypothetical protein CAPTEDRAFT_221395 [Capitella ( 233) 289 78.9 4.6e-12 ref|XP_003109030.1| CRE-GST-7 protein [Caenorh ( 206) 288 78.7 4.7e-12 hypothetical protein DAPPUDRAFT_302333 [Daphnia pu ( 206) 288 78.7 4.7e-12 hypothetical protein CAEBREN_24553 [Caenorhabditis ( 206) 288 78.7 4.7e-12 ref|XP_003108942.1| CRE-GST-9 protein [Caenorh ( 206) 288 78.7 4.7e-12 ref|NP_494884.1| Protein GST-8 [Caenorhabditis ( 206) 288 78.7 4.7e-12 ref|NP_001254267.1| Protein GST-5, isoform a [ ( 207) 288 78.7 4.7e-12 ref|XP_786633.3| PREDICTED: S-crystallin 4-lik ( 208) 288 78.7 4.7e-12 hypothetical protein CAEBREN_15403 [Caenorhabditis ( 209) 288 78.7 4.7e-12 ref|XP_007884571.1| PREDICTED: glutathione S-t ( 210) 288 78.7 4.8e-12 allergen Ale o 8 [Aleuroglyphus ovatus] ( 219) 288 78.7 5e-12 ref|XP_003136908.1| hypothetical protein LOAG_ ( 222) 288 78.7 5.1e-12 hypothetical protein WUBG_12344, partial [Wucherer ( 196) 287 78.5 5.2e-12 ref|XP_002605340.1| hypothetical protein BRAFL ( 198) 287 78.5 5.2e-12 ref|NP_001156063.1| glutathione S-transferase- ( 202) 287 78.5 5.4e-12 Glutathione S-transferase domain containing protei ( 205) 287 78.5 5.5e-12 Glutathione S-transferase domain containing protei ( 207) 287 78.4 5.5e-12 hypothetical protein CAEBREN_03706 [Caenorhabditis ( 213) 287 78.4 5.8e-12 mu-class gst glutathione S-transferase [Cipangopal ( 215) 287 78.4 5.8e-12 ref|XP_008608309.1| hypothetical protein SDRG_ ( 221) 287 78.4 6e-12 ref|XP_002119880.1| PREDICTED: glutathione S-t ( 225) 287 78.4 6.2e-12 ref|XP_004348817.1| hypothetical protein CAOG_ ( 204) 286 78.2 6.4e-12 Glutathione S-transferase [Harpegnathos saltator] ( 204) 286 78.2 6.4e-12 ref|XP_002111647.1| expressed hypothetical pro ( 205) 286 78.2 6.5e-12 ref|XP_002731493.1| PREDICTED: S-crystallin SL ( 206) 286 78.2 6.5e-12 hypothetical protein Y032_0110g153 [Ancylostoma ce ( 206) 286 78.2 6.5e-12 glutathione S-transferase Pi-2 [Mercenaria mercena ( 207) 286 78.2 6.6e-12 ref|NP_503532.1| Protein GST-37 [Caenorhabditis ( 209) 286 78.2 6.7e-12 ref|XP_002165697.1| PREDICTED: glutathione S-t ( 210) 286 78.2 6.7e-12 glutathione S-transferase pi 2, partial [Mus spret ( 188) 285 78.0 6.9e-12 ref|XP_001634653.1| predicted protein [Nematos ( 215) 286 78.2 6.9e-12 ref|XP_781175.1| PREDICTED: S-crystallin 4-like ( 223) 286 78.2 7.3e-12 hypothetical protein YQE_03116, partial [Dendrocto ( 202) 285 78.0 7.5e-12 pdb|1TW9|A Chain A, Glutathione Transferase-2, ( 206) 285 78.0 7.7e-12 ref|XP_005999339.1| PREDICTED: glutathione S-t ( 186) 284 77.8 8e-12 ref|NP_503968.1| Protein GST-33 [Caenorhabditis ( 213) 285 77.9 8.1e-12 pi-class glutathione S-transferase, partial [Gobio ( 189) 284 77.8 8.2e-12 glutathione S-transferase mu [Haliotis discus hann ( 215) 285 77.9 8.2e-12 hypothetical protein CAPTEDRAFT_21681 [Capitella t ( 215) 285 77.9 8.2e-12 Glutathione S-transferase Mu 1, partial [Stegodyph ( 216) 285 77.9 8.2e-12 hypothetical protein CAEBREN_30539 [Caenorhabditis ( 224) 285 77.9 8.6e-12 ref|XP_003371755.1| glutathione S-transferase ( 203) 284 77.7 9e-12 glutathione S-transferase 2 [Heligmosomoides polyg ( 204) 284 77.7 9.1e-12 cytosolic glutathione S-transferase 1 [Oesophagost ( 206) 284 77.7 9.2e-12 CBN-GST-1 protein [Caenorhabditis brenneri] ( 208) 284 77.7 9.3e-12 CBN-GST-38 protein [Caenorhabditis brenneri] ( 209) 284 77.7 9.3e-12 Glutathione S-transferase 1 [Oxytricha trifallax] ( 210) 284 77.7 9.4e-12 ref|XP_002158423.1| PREDICTED: glutathione S-t ( 214) 284 77.7 9.6e-12 glutathione S-transferase class mu [Cyphoma gibbos ( 215) 284 77.7 9.7e-12 glutathione s-transferase pi [Pfiesteria piscicida ( 218) 284 77.7 9.9e-12 hypothetical protein SPRG_12377 [Saprolegnia paras ( 221) 284 77.7 1e-11 glutathione S-transferase [Rhipicephalus appendicu ( 223) 284 77.7 1e-11 glutathione S-transferase sigma 2 [Aphis gossypii] ( 203) 283 77.5 1.1e-11 ref|XP_002610389.1| hypothetical protein BRAFL ( 203) 283 77.5 1.1e-11 sp|P46436.3|GST1_ASCSU RecName: Full=Glutathione ( 206) 283 77.5 1.1e-11 hypothetical protein CAEBREN_04473 [Caenorhabditis ( 209) 283 77.5 1.1e-11 Glutathione S-transferase [Oxytricha trifallax] ( 210) 283 77.5 1.1e-11 ref|XP_009044718.1| hypothetical protein LOTGI ( 212) 283 77.5 1.1e-11 allergen Lep d 8 [Lepidoglyphus destructor] ( 214) 283 77.5 1.1e-11 rCG48611, isoform CRA_b [Rattus norvegicus] ( 191) 282 77.3 1.2e-11 26.5 kDa glutathione transferase recombinant prote ( 221) 283 77.4 1.2e-11 glutathione S transferase [Hymenolepis microstoma] ( 224) 283 77.4 1.2e-11 ref|XP_002610390.1| hypothetical protein BRAFL ( 201) 282 77.2 1.2e-11 glutathione S-transferase sigma 1 [Aphis gossypii] ( 203) 282 77.2 1.3e-11 glutathione-S-transferase [Trichinella pseudospira ( 206) 282 77.2 1.3e-11 ref|XP_002630606.1| C. briggsae CBR-GST-9 prot ( 206) 282 77.2 1.3e-11 ref|NP_497123.2| Protein GST-32 [Caenorhabditis ( 209) 282 77.2 1.3e-11 hypothetical protein CAEBREN_14802 [Caenorhabditis ( 209) 282 77.2 1.3e-11 glutathione S-transferase [Plasmodium vinckei pett ( 209) 282 77.2 1.3e-11 Gly d 8 [Glycyphagus domesticus] ( 214) 282 77.2 1.4e-11 unnamed protein product [Blastocystis hominis] ( 196) 281 77.0 1.4e-11 ref|XP_005965793.1| PREDICTED: glutathione S-t ( 226) 282 77.2 1.5e-11 ref|XP_006572107.1| PREDICTED: glutathione S-t ( 176) 280 76.8 1.5e-11 hematopoietic prostaglandin D synthase [Penaeus mo ( 203) 281 77.0 1.5e-11 hypothetical protein SINV_80577 [Solenopsis invict ( 205) 281 77.0 1.5e-11 hypothetical protein CAEBREN_23154 [Caenorhabditis ( 206) 281 77.0 1.5e-11 ref|XP_001639531.1| predicted protein [Nematos ( 208) 281 77.0 1.5e-11 glutathione S-transferase [Ctenopharyngodon idella ( 161) 279 76.6 1.5e-11 ref|NP_497119.1| Protein GST-39 [Caenorhabditis ( 209) 281 77.0 1.6e-11 ref|XP_002163429.1| PREDICTED: glutathione S-t ( 210) 281 77.0 1.6e-11 ref|XP_785609.1| PREDICTED: glutathione S-trans ( 213) 281 77.0 1.6e-11 allergen Ale o 8 [Aleuroglyphus ovatus] ( 216) 281 77.0 1.6e-11 glutathione S-transferase [Prionchulus punctatus] ( 218) 281 77.0 1.6e-11 ref|XP_002400734.1| glutathione S-transferase, ( 248) 282 77.1 1.6e-11 ref|XP_007670367.1| PREDICTED: LOW QUALITY PRO ( 170) 279 76.6 1.7e-11 ref|XP_007070193.1| PREDICTED: glutathione S-t ( 220) 281 77.0 1.7e-11 glutathione S-transferase mu6 [Tetranychus cinnaba ( 225) 281 76.9 1.7e-11 glutathione S-transferase [Solenopsis invicta] ( 202) 280 76.7 1.8e-11 ref|NP_001165924.1| glutathione S-transferase ( 202) 280 76.7 1.8e-11 glutathione S-transferase [Solenopsis invicta] ( 202) 280 76.7 1.8e-11 glutathione S-transferase sigma class protein [Cra ( 203) 280 76.7 1.8e-11 glutathione S-transferase sigma 3 [Locusta migrato ( 204) 280 76.7 1.8e-11 ref|NP_001022266.1| Protein GST-9 [Caenorhabdit ( 206) 280 76.7 1.8e-11 hypothetical protein CAEBREN_08009 [Caenorhabditis ( 206) 280 76.7 1.8e-11 ref|XP_003092683.1| CRE-GST-1 protein [Caenorh ( 208) 280 76.7 1.8e-11 glutathione s-pi 1 [Stylonychia lemnae] ( 212) 280 76.7 1.9e-11 ref|XP_639027.1| hypothetical protein DDB_G0283 ( 198) 279 76.5 2e-11 ref|XP_002605352.1| hypothetical protein BRAFL ( 202) 279 76.5 2.1e-11 Glutathione S-transferase [Acromyrmex echinatior] ( 202) 279 76.5 2.1e-11 glutathione S-transferase pi-class [Corbicula flum ( 205) 279 76.5 2.1e-11 ref|XP_002111791.1| expressed hypothetical pro ( 208) 279 76.5 2.2e-11 ref|XP_002638302.1| C. briggsae CBR-GST-38 pro ( 209) 279 76.5 2.2e-11 26.5 kDa glutathione S-transferase [Taenia solium] ( 217) 279 76.5 2.3e-11 ref|XP_005965775.1| PREDICTED: glutathione S-t ( 193) 278 76.3 2.3e-11 mCG3869, isoform CRA_a [Mus musculus] ( 193) 278 76.3 2.3e-11 glutathione S-transferase [Rhipicephalus microplus ( 223) 279 76.5 2.4e-11 RHTO0S39e00254g1_1 [Rhodosporidium toruloides] ( 226) 279 76.5 2.4e-11 ref|NP_001153742.1| glutathione S-transferase ( 204) 278 76.3 2.5e-11 sigma-class glutathione S-transferase [Apis cerana ( 204) 278 76.3 2.5e-11 ref|XP_003109072.1| hypothetical protein CRE_1 ( 398) 283 77.2 2.6e-11 hypothetical protein CAPTEDRAFT_86198, partial [Ca ( 214) 278 76.2 2.7e-11 glutathione S-transferase pi, isoform CRA_a [Homo ( 191) 277 76.0 2.7e-11 glutathione s transferase mu [Echinococcus granulo ( 220) 278 76.2 2.8e-11 glutathione S-transferase [Rhipicephalus microplus ( 223) 278 76.2 2.8e-11 glutathione S transferase [Echinococcus granulosus ( 201) 277 76.0 2.9e-11 glutathione S-transferase-1 [Meloidogyne incognita ( 203) 277 76.0 2.9e-11 Glutathione S-transferase [Camponotus floridanus] (1080) 290 78.4 3e-11 glutathione S-transferase sigma [Tenebrio molitor] ( 204) 277 76.0 3e-11 pi-class glutathione S-transferase [Ruditapes phil ( 205) 277 76.0 3e-11 hypothetical protein CAEBREN_16327 [Caenorhabditis ( 206) 277 76.0 3e-11 glutathione S-transferase sigma 2 [Mytilus gallopr ( 207) 277 76.0 3e-11 Glutathione S-transferase [Acromyrmex echinatior] ( 207) 277 76.0 3e-11 hypothetical protein D910_02436 [Dendroctonus pond ( 187) 276 75.8 3.1e-11 glutathione S transferase, partial [Echinococcus m ( 216) 277 76.0 3.2e-11 ref|XP_007171143.1| PREDICTED: glutathione S-t ( 191) 276 75.8 3.2e-11 glutathione S-transferase [Fasciola hepatica] ( 218) 277 76.0 3.2e-11 glutathione S-transferase [Rhipicephalus microplus ( 223) 277 76.0 3.3e-11 glutathione S-transferase [Rhipicephalus microplus ( 223) 277 76.0 3.3e-11 ref|XP_007063065.1| PREDICTED: hematopoietic p ( 199) 276 75.8 3.4e-11 hypothetical protein DAPPUDRAFT_223730 [Daphnia pu ( 201) 276 75.8 3.4e-11 ref|XP_005343744.1| PREDICTED: glutathione S-t ( 210) 276 75.8 3.7e-11 hypothetical protein CAPTEDRAFT_150487 [Capitella ( 214) 276 75.7 3.7e-11 glutathione S-transferase class mu [Cyphoma gibbos ( 215) 276 75.7 3.8e-11 glutathione S-transferases [Macrobrachium nipponen ( 216) 276 75.7 3.8e-11 pdb|2WRT|A Chain A, The 2.4 Angstrom Structure ( 218) 276 75.7 3.8e-11 glutathione S-transferase [Fasciola hepatica] ( 218) 276 75.7 3.8e-11 Unknown (protein for IMAGE:3399306), partial [Xeno ( 195) 275 75.5 3.9e-11 hypothetical protein PPL_03057 [Polysphondylium pa ( 199) 275 75.5 4e-11 ref|NP_001280393.1| uncharacterized protein LO ( 202) 275 75.5 4.1e-11 ref|XP_003703956.1| PREDICTED: glutathione S-t ( 202) 275 75.5 4.1e-11 glutathione-S-transferase [Trichinella spiralis] ( 205) 275 75.5 4.2e-11 hypothetical protein DAPPUDRAFT_241024 [Daphnia pu ( 208) 275 75.5 4.3e-11 ref|XP_002642424.1| C. briggsae CBR-GST-1 prot ( 208) 275 75.5 4.3e-11 ref|XP_002631491.1| C. briggsae CBR-GST-39 pro ( 209) 275 75.5 4.3e-11 hypothetical protein CAEBREN_12715 [Caenorhabditis ( 209) 275 75.5 4.3e-11 ref|XP_002643718.1| C. briggsae CBR-GST-36 pro ( 210) 275 75.5 4.3e-11 ref|XP_001200261.2| PREDICTED: S-crystallin SL ( 216) 275 75.5 4.5e-11 ref|XP_006276942.1| PREDICTED: glutathione S-t ( 191) 274 75.3 4.5e-11 ref|XP_002593173.1| hypothetical protein BRAFL ( 218) 275 75.5 4.5e-11 ref|XP_008707305.1| PREDICTED: glutathione S-t ( 193) 274 75.3 4.6e-11 Glutathione S-transferase [Camponotus floridanus] ( 202) 274 75.3 4.9e-11 hypothetical protein CAPTEDRAFT_177148 [Capitella ( 205) 274 75.3 5e-11 ref|XP_003102721.1| CRE-GST-3 protein [Caenorh ( 207) 274 75.3 5e-11 ref|XP_002610952.1| hypothetical protein BRAFL ( 207) 274 75.3 5e-11 ref|XP_004087903.1| PREDICTED: LOW QUALITY PRO ( 209) 274 75.3 5.1e-11 hypothetical protein CAEBREN_19495 [Caenorhabditis ( 210) 274 75.3 5.1e-11 glutathione S-transferase mu [Reishia clavigera] ( 217) 274 75.2 5.4e-11 glutathione S-transferase, GST [Schistosoma manson ( 218) 274 75.2 5.4e-11 glutathione S-transferase [Fasciola hepatica] ( 218) 274 75.2 5.4e-11 26kD glutathione S-transferase [Schistosoma mekong ( 218) 274 75.2 5.4e-11 ref|XP_003742682.1| PREDICTED: glutathione S-t ( 222) 274 75.2 5.5e-11 ref|XP_005278517.1| PREDICTED: hematopoietic p ( 199) 273 75.0 5.7e-11 ref|XP_002128171.1| PREDICTED: glutathione S-t ( 200) 273 75.0 5.7e-11 Glutathione S-transferase [Harpegnathos saltator] ( 202) 273 75.0 5.8e-11 sigma class glutathione-s-transferase 2 [Haliotis ( 202) 273 75.0 5.8e-11 putative glutathione S-transferase [Polysphondyliu ( 203) 273 75.0 5.8e-11 sigma class glutathione-s-transferase 2 [Azumapect ( 205) 273 75.0 5.9e-11 ref|XP_005093728.1| PREDICTED: glutathione S-t ( 219) 273 75.0 6.4e-11 ref|WP_013940225.1| glutathione S-transferase ( 222) 273 75.0 6.5e-11 ref|XP_009049470.1| hypothetical protein LOTGI ( 197) 272 74.8 6.6e-11 ref|XP_644019.1| hypothetical protein DDB_G0274 ( 225) 273 75.0 6.7e-11 ref|WP_011553641.1| glutathione S-transferase ( 228) 273 75.0 6.8e-11 ref|XP_004356657.1| glutathione Stransferase, ( 228) 273 75.0 6.8e-11 ref|XP_002610391.1| hypothetical protein BRAFL ( 201) 272 74.8 6.8e-11 ref|NP_503889.1| Protein GST-23 [Caenorhabditis ( 208) 272 74.8 7.1e-11 ref|NP_497117.1| Protein GST-28 [Caenorhabditis ( 209) 272 74.8 7.1e-11 sp|P30112.3|GST26_FASHE RecName: Full=Glutathione ( 218) 272 74.8 7.6e-11 glutathione transferase mu class Yv5004H11 [Sarcop ( 219) 272 74.8 7.6e-11 ref|XP_007829487.1| hypothetical protein PFICI ( 229) 272 74.7 8.1e-11 glutathione S-transferase-like protein [Aphis citr ( 203) 271 74.5 8.2e-11 hypothetical protein CAEBREN_16021 [Caenorhabditis ( 210) 271 74.5 8.5e-11 glutathione S-transferase [Taenia solium] ( 219) 271 74.5 9e-11 glutathione s transferase mu [Echinococcus multilo ( 220) 271 74.5 9.1e-11 glutathione S-transferase [Rhipicephalus microplus ( 223) 271 74.5 9.2e-11 glutathione S-transferase [Haemaphysalis longicorn ( 223) 271 74.5 9.2e-11 ref|XP_009059358.1| hypothetical protein LOTGI ( 199) 270 74.3 9.4e-11 ref|XP_001634652.1| predicted protein [Nematos ( 227) 271 74.5 9.4e-11 ref|XP_002400733.1| glutathione S-transferase, ( 229) 271 74.5 9.6e-11 Glutathione S-transferase [Harpegnathos saltator] ( 202) 270 74.3 9.6e-11 GST4 [Azumapecten farreri] ( 205) 270 74.3 9.8e-11 Glutathione S-transferase [Crassostrea gigas] ( 207) 270 74.3 9.9e-11 Glutathione S-transferase [Harpegnathos saltator] ( 237) 271 74.5 1e-10 ref|XP_003116698.1| CRE-GST-38 protein [Caenor ( 209) 270 74.3 1e-10 ref|XP_006813113.1| PREDICTED: glutathione S-t ( 213) 270 74.3 1e-10 ref|XP_004335923.1| glutathione transferase fa ( 216) 270 74.3 1e-10 putative glutathione S-transferase [Polysphondyliu ( 195) 269 74.1 1.1e-10 ref|XP_007169514.1| PREDICTED: glutathione S-t ( 225) 270 74.3 1.1e-10 ref|XP_005104553.1| PREDICTED: probable glutat ( 203) 269 74.1 1.1e-10 ref|XP_970714.1| PREDICTED: glutathione S-trans ( 204) 269 74.1 1.2e-10 ref|XP_003108993.1| CRE-GST-6 protein [Caenorh ( 206) 269 74.0 1.2e-10 glutathione S-transferase 2 [Ancylostoma duodenale ( 206) 269 74.0 1.2e-10 ref|XP_003097116.1| CRE-GST-13 protein [Caenor ( 206) 269 74.0 1.2e-10 hypothetical protein OXYTRI_06606 [Oxytricha trifa ( 211) 269 74.0 1.2e-10 pdb|1FHE|A Chain A, Glutathione Transferase (F ( 217) 269 74.0 1.2e-10 sp|P31670.3|GST27_FASHE RecName: Full=Glutathion ( 218) 269 74.0 1.3e-10 ref|XP_005783630.1| hypothetical protein EMIHU ( 219) 269 74.0 1.3e-10 ref|XP_003414124.1| PREDICTED: hematopoietic p ( 199) 268 73.8 1.3e-10 glutathione S-transferase [Corbicula fluminea] ( 200) 268 73.8 1.3e-10 glutathionetransferase [Riptortus pedestris] ( 202) 268 73.8 1.3e-10 ref|XP_003245722.1| PREDICTED: glutathione S-t ( 205) 268 73.8 1.4e-10 glutathione S-transferase sigma [Tenebrio molitor] ( 208) 268 73.8 1.4e-10 ref|NP_497121.1| Protein GST-31 [Caenorhabditis ( 210) 268 73.8 1.4e-10 Glutathione S-transferase A1 [Talaromyces marneffe ( 213) 268 73.8 1.4e-10 glutathione S-transferase [Fasciola gigantica] ( 218) 268 73.8 1.5e-10 hypothetical protein PPL_09758 [Polysphondylium pa ( 547) 275 75.1 1.5e-10 ref|XP_009053627.1| hypothetical protein LOTGI ( 197) 267 73.6 1.5e-10 ref|XP_002605351.1| hypothetical protein BRAFL ( 197) 267 73.6 1.5e-10 ref|XP_007449368.1| PREDICTED: glutathione S-t ( 225) 268 73.8 1.6e-10 hypothetical protein Y032_0155g3086 [Ancylostoma c ( 256) 269 73.9 1.6e-10 glutathione S transferase [Echinococcus multilocul ( 201) 267 73.6 1.6e-10 ref|XP_001608225.1| PREDICTED: glutathione S-t ( 202) 267 73.6 1.6e-10 ref|NP_001165923.1| glutathione S-transferase ( 202) 267 73.6 1.6e-10 ref|XP_003386865.1| PREDICTED: glutathione S-t ( 230) 268 73.8 1.6e-10 ref|XP_009050026.1| hypothetical protein LOTGI ( 204) 267 73.6 1.6e-10 ref|NP_001136128.1| glutathione S-transferase ( 206) 267 73.6 1.6e-10 ref|XP_003689705.1| PREDICTED: glutathione S-t ( 206) 267 73.6 1.6e-10 ref|XP_002479794.1| glutathione S-transferase, ( 207) 267 73.6 1.6e-10 ref|XP_005828261.1| hypothetical protein GUITH ( 208) 267 73.6 1.7e-10 ref|XP_002945626.1| hypothetical protein VOLCA ( 269) 269 73.9 1.7e-10 ref|NP_497118.1| Protein GST-29 [Caenorhabditis ( 209) 267 73.6 1.7e-10 ref|XP_003115566.1| CRE-GST-33 protein [Caenor ( 213) 267 73.5 1.7e-10 pdb|2FHE|A Chain A, Fasciola Hepatica Glutathion ( 216) 267 73.5 1.7e-10 ref|NP_499981.1| Protein GST-40 [Caenorhabditis ( 216) 267 73.5 1.7e-10 ref|XP_001372551.1| PREDICTED: glutathione S-t ( 218) 267 73.5 1.8e-10 glutathione S-transferase [Psoroptes ovis] ( 220) 267 73.5 1.8e-10 pdb|2HNL|A Chain A, Structure Of The Prostagla ( 225) 267 73.5 1.8e-10 ref|XP_007106539.1| PREDICTED: glutathione S-t ( 225) 267 73.5 1.8e-10 glutathione S-transferase mu3 [Tetranychus cinnaba ( 227) 267 73.5 1.9e-10 glutathione S transferase S1 [Papilio xuthus] ( 204) 266 73.3 1.9e-10 pdb|2ON5|A Chain A, Structure Of Nagst-2 gi|15 ( 206) 266 73.3 1.9e-10 sp|P46434.1|GST1_ONCVO RecName: Full=Glutathione ( 235) 267 73.5 1.9e-10 ref|XP_006560566.1| PREDICTED: glutathione S-t ( 208) 266 73.3 2e-10 ref|XP_002162176.1| PREDICTED: glutathione S-t ( 209) 266 73.3 2e-10 hypothetical protein PHYSODRAFT_478522 [Phytophtho ( 594) 274 74.8 2e-10 glutathione S-transferase [Echinococcus multilocul ( 219) 266 73.3 2.1e-10 ref|XP_007094188.1| PREDICTED: glutathione S-t ( 193) 265 73.1 2.1e-10 glutathione S-transferase Ia [Onchocerca volvulus] ( 250) 267 73.5 2.1e-10 glutathione S-transferase [Rhipicephalus sanguineu ( 223) 266 73.3 2.2e-10 glutathione-S-transferase isoform 2 [Haliotis disc ( 226) 266 73.3 2.2e-10 prostaglandin D2 synthase-like protein [Daphnia pu ( 227) 266 73.3 2.2e-10 hypothetical protein PPL_09748 [Polysphondylium pa ( 201) 265 73.1 2.2e-10 Glutathione S-transferase [Camponotus floridanus] ( 202) 265 73.1 2.2e-10 Glutathione S-transferase [Cerapachys biroi] ( 202) 265 73.1 2.2e-10 ref|XP_005770847.1| glutathione S-transferase ( 231) 266 73.3 2.3e-10 S-crystallin [Nototodarus sloanii] ( 205) 265 73.1 2.3e-10 ref|XP_002631478.1| C. briggsae CBR-GST-5 prot ( 205) 265 73.1 2.3e-10 sp|P18426.1|SCR11_OMMSL RecName: Full=S-crystalli ( 205) 265 73.1 2.3e-10 glutathione-S-transferase [Trichinella nativa] ( 205) 265 73.1 2.3e-10 ref|XP_002629695.1| C. briggsae CBR-GST-13 pro ( 206) 265 73.1 2.3e-10 ref|XP_006616041.1| PREDICTED: glutathione S-t ( 206) 265 73.1 2.3e-10 Glutathione S-transferase [Ectocarpus siliculosus] ( 207) 265 73.1 2.3e-10 ref|NP_501846.1| Protein GST-3 [Caenorhabditis ( 207) 265 73.1 2.3e-10 sp|P31671.3|GST28_FASHE RecName: Full=Glutathion ( 218) 265 73.0 2.5e-10 Glutathione S-transferase [Echinococcus granulosus ( 219) 265 73.0 2.5e-10 glutathione S-transferase [Echinococcus granulosus ( 219) 265 73.0 2.5e-10 putative glutathione S-transferase [Dermacentor va ( 223) 265 73.0 2.6e-10 glutathion S transferase [Cloning vector pDM193] ( 223) 265 73.0 2.6e-10 ref|XP_006197484.1| PREDICTED: glutathione S-t ( 226) 265 73.0 2.6e-10 hypothetical protein PPL_05646 [Polysphondylium pa ( 200) 264 72.8 2.6e-10 ref|XP_002605354.1| hypothetical protein BRAFL ( 200) 264 72.8 2.6e-10 ref|XP_007508012.1| PREDICTED: LOW QUALITY PRO ( 203) 264 72.8 2.7e-10 ref|XP_002668053.1| predicted protein [Naegler ( 160) 262 72.5 2.7e-10 ref|NP_495967.1| Protein GST-13 [Caenorhabditis ( 208) 264 72.8 2.8e-10 pi class glutathione S-transferase [Laternula elli ( 209) 264 72.8 2.8e-10 glutathione s- [Stylonychia lemnae] ( 210) 264 72.8 2.8e-10 hypothetical protein CAEBREN_28051 [Caenorhabditis ( 213) 264 72.8 2.8e-10 Tyr p 8 allergen [Tyrophagus putrescentiae] ( 218) 264 72.8 2.9e-10 glutathione-S-transferase [Cloning vector pDXA-GST ( 248) 265 73.0 2.9e-10 fusion peptide [synthetic construct] ( 251) 265 73.0 3e-10 ref|XP_002783355.1| Glutathione S-transferase, ( 224) 264 72.8 3e-10 glutathione S-transferase mu5 [Tetranychus cinnaba ( 225) 264 72.8 3.1e-10 ref|NP_001040025.1| glutathione S-transferase ( 225) 264 72.8 3.1e-10 ref|XP_002402683.1| glutathione S-transferase, ( 228) 264 72.8 3.1e-10 ref|XP_002111324.1| hypothetical protein TRIAD ( 209) 263 72.6 3.3e-10 putative: Glutathione S-Transferase family member ( 210) 263 72.6 3.3e-10 ref|XP_003728866.1| PREDICTED: glutathione S-t ( 213) 263 72.6 3.4e-10 ref|XP_004689736.1| PREDICTED: glutathione S-t ( 225) 263 72.5 3.6e-10 ref|NP_001231987.1| glutathione-requiring pros ( 198) 262 72.4 3.6e-10 ref|XP_002610317.1| hypothetical protein BRAFL ( 202) 262 72.3 3.7e-10 glutathione S-transferase S4 [Apis cerana cerana] ( 203) 262 72.3 3.7e-10 glutathione S transferase class sigma [Blattella g ( 204) 262 72.3 3.8e-10 glutathione S-transferase GST-pi [Mytilus edulis] ( 180) 261 72.2 3.8e-10 glutathione-S-transferase [Expression vector pVTLU ( 215) 262 72.3 4e-10 glutathione S transferase:ISOTYPE=GST47 ( 217) 262 72.3 4.1e-10 glutathione S-transferase [Dugesia japonica] ( 218) 262 72.3 4.1e-10 sp|P08515.3|GST26_SCHJA RecName: Full=Glutathione ( 218) 262 72.3 4.1e-10 pdb|3QMZ|T Chain T, Crystal Structure Of The C ( 219) 262 72.3 4.1e-10 glutathione transferase (EC 2.5.1.18) - fluke (Sch ( 219) 262 72.3 4.1e-10 N-terminal GST protein tag, partial [Expression ve ( 220) 262 72.3 4.2e-10 ref|XP_002401749.1| glutathione S-transferase, ( 223) 262 72.3 4.2e-10 pdb|1Y6E|A Chain A, Orthorhombic Glutathione S- ( 223) 262 72.3 4.2e-10 glutathione-S-transferase affinity tag [Cloning ve ( 224) 262 72.3 4.3e-10 ref|XP_006065036.1| PREDICTED: glutathione S-t ( 225) 262 72.3 4.3e-10 ref|XP_004002347.1| PREDICTED: glutathione S-t ( 225) 262 72.3 4.3e-10 ref|NP_001231868.1| glutathione S-transferase ( 225) 262 72.3 4.3e-10 glutathione transferase [unidentified cloning vect ( 226) 262 72.3 4.3e-10 glutathione transferase [unidentified cloning vect ( 228) 262 72.3 4.4e-10 hypothetical protein PHYSODRAFT_344498 [Phytophtho ( 203) 261 72.1 4.4e-10 glutathione S-transferase sigma [Danaus plexippus] ( 204) 261 72.1 4.5e-10 glutathione-S-transferase [synthetic construct] ( 232) 262 72.3 4.5e-10 pdb|1GNE|A Chain A, The Three-dimensional Stru ( 232) 262 72.3 4.5e-10 glutathione S-transferase [unidentified cloning ve ( 232) 262 72.3 4.5e-10 glutathione S-transferase [unidentified cloning ve ( 232) 262 72.3 4.5e-10 glutathione S-transferase [unidentified cloning ve ( 233) 262 72.3 4.5e-10 hypothetical protein CAPTEDRAFT_123552 [Capitella ( 205) 261 72.1 4.5e-10 glutathione S-transferase B [Ruditapes philippinar ( 205) 261 72.1 4.5e-10 ref|XP_001952040.2| PREDICTED: glutathione S-t ( 205) 261 72.1 4.5e-10 pdb|1DUG|A Chain A, Structure Of The Fibrinogen ( 234) 262 72.3 4.5e-10 glutathione-S-transferase [Flexi Vector pFN2K (GST ( 235) 262 72.3 4.5e-10 glutathione S-transferase protein [Necator america ( 393) 266 73.0 4.6e-10 glutathione S-transferase [Cloning vector pQLinkGD ( 236) 262 72.3 4.6e-10 glutathione S-transferase GSTP2-2 [Bufo bufo] ( 184) 260 71.9 4.6e-10 glutathione S-transferase [unidentified cloning ve ( 238) 262 72.3 4.6e-10 glutathione S-transferase [Expression vector pESP- ( 238) 262 72.3 4.6e-10 ref|WP_008430144.1| glutathione S-transferase ( 239) 262 72.3 4.7e-10 glutathione S-transferase [unidentified cloning ve ( 239) 262 72.3 4.7e-10 glutathione S-transferase [unidentified cloning ve ( 239) 262 72.3 4.7e-10 glutathione S-transferase [unidentified cloning ve ( 240) 262 72.3 4.7e-10 glutathione S-transferase [unidentified cloning ve ( 240) 262 72.3 4.7e-10 GST-fusion protein [Expression vector pXen-1] ( 240) 262 72.3 4.7e-10 GST Pi, partial [Mytilus coruscus] ( 144) 258 71.5 4.7e-10 glutathione S-transferase [unidentified cloning ve ( 242) 262 72.3 4.7e-10 glutathione S-transferase [Cloning vector pGEX-6P- ( 243) 262 72.3 4.8e-10 glutathione S-transferase [Cloning vector pGEX-6P- ( 244) 262 72.3 4.8e-10 GST-fusion protein [Expression vector pXen-3] ( 244) 262 72.3 4.8e-10 glutathione S-transferase [Cloning vector pGEX-6P- ( 245) 262 72.3 4.8e-10 ref|XP_005197423.1| PREDICTED: glutathione S-t ( 191) 260 71.9 4.9e-10 glutathione S transferase D1 [Procambarus clarkii] ( 218) 261 72.1 4.9e-10 glutathione S-transferase [Cloning vector pD-GEX1] ( 248) 262 72.2 4.9e-10 ref|XP_005801385.1| PREDICTED: glutathione S-t ( 219) 261 72.1 4.9e-10 glutathione-S-transferase [Cloning vector pEG(KT)] ( 250) 262 72.2 4.9e-10 glutathione-S-transferase [Cloning vector pEG(KG)] ( 250) 262 72.2 4.9e-10 glutathione S-transferase Ib [Onchocerca volvulus] ( 250) 262 72.2 4.9e-10 ref|XP_001381960.1| PREDICTED: glutathione S-t ( 220) 261 72.1 4.9e-10 glutathione S-transferase [Cloning vector pQLinkG] ( 251) 262 72.2 5e-10 glutathione S-transferase [Rhipicephalus microplus ( 223) 261 72.1 5e-10 pdb|1BG5|A Chain A, Crystal Structure Of The A ( 254) 262 72.2 5e-10 hypothetical protein H257_07866 [Aphanomyces astac ( 224) 261 72.1 5.1e-10 glutathione S-transferase C-terminal-like protein ( 225) 261 72.1 5.1e-10 ref|XP_005677994.1| PREDICTED: glutathione S-t ( 225) 261 72.1 5.1e-10 ref|XP_006763040.1| PREDICTED: glutathione S-t ( 225) 261 72.1 5.1e-10 ref|NP_990342.1| hematopoietic prostaglandin D ( 199) 260 71.9 5.1e-10 ref|XP_004387076.1| PREDICTED: hematopoietic p ( 199) 260 71.9 5.1e-10 GST-6his [Expression vector pGEX-2T-6His-PL2] ( 262) 262 72.2 5.3e-10 hypothetical protein CAPTEDRAFT_88442, partial [Ca ( 157) 258 71.5 5.3e-10 glutathionetransferase [Riptortus pedestris] ( 203) 260 71.9 5.3e-10 glutathione S-transferase [Expression vector pGST- ( 263) 262 72.2 5.3e-10 GST-fusion protein [Expression vector pXen-2] ( 263) 262 72.2 5.3e-10 sigma glutathione S-transferase [Locusta migratori ( 204) 260 71.9 5.3e-10 hypothetical protein CAPTEDRAFT_117366 [Capitella ( 205) 260 71.8 5.3e-10 glutathione S-transferase [Expression vector pcGlo ( 266) 262 72.2 5.4e-10 GST-6his [Expression vector pGEX-2T-6H] ( 268) 262 72.2 5.4e-10 ref|NP_509652.2| Protein GST-36 [Caenorhabditis ( 210) 260 71.8 5.5e-10 glutathione s-transferase [Stylonychia lemnae] ( 212) 260 71.8 5.6e-10 pdb|1B8X|A Chain A, Glutathione S-transferase Fu ( 280) 262 72.2 5.7e-10 ref|XP_004582018.1| PREDICTED: glutathione S-t ( 218) 260 71.8 5.8e-10 multivalent antigen sjFABP-26 [synthetic construct ( 365) 264 72.6 5.8e-10 ref|XP_002400726.1| glutathione S-transferase, ( 220) 260 71.8 5.9e-10 ref|XP_005639287.1| PREDICTED: glutathione S-t ( 225) 260 71.8 6e-10 ref|XP_004620129.1| PREDICTED: glutathione S-t ( 225) 260 71.8 6e-10 ref|XP_003472152.1| PREDICTED: hematopoietic p ( 199) 259 71.6 6.1e-10 glutathione S-transferase S2 [Laodelphax striatell ( 202) 259 71.6 6.2e-10 GST-stuffer fusion protein [Cloning vector pGEX-PU ( 298) 262 72.2 6.2e-10 glutathione S-transferase sigma 6 [Locusta migrato ( 204) 259 71.6 6.3e-10 ref|XP_002414672.1| glutathione S-transferase, ( 205) 259 71.6 6.3e-10 ref|XP_003290205.1| hypothetical protein DICPU ( 206) 259 71.6 6.4e-10 ref|XP_002633726.1| C. briggsae CBR-GST-3 prot ( 207) 259 71.6 6.4e-10 mu-glutathione transferase, partial [Fasciola hepa ( 211) 259 71.6 6.6e-10 hypothetical protein CAEBREN_18023 [Caenorhabditis ( 213) 259 71.6 6.6e-10 GST-mu [Perinereis nuntia] ( 171) 257 71.2 7e-10 ref|XP_005073818.1| PREDICTED: uncharacterized ( 224) 259 71.6 7.1e-10 glutathione S-transferase mu2 [Panonychus citri] ( 224) 259 71.6 7.1e-10 glutathione S-transferase [Expression vector pBKHG ( 224) 259 71.6 7.1e-10 ref|XP_002783350.1| Glutathione S-transferase, ( 224) 259 71.6 7.1e-10 ref|XP_006979556.1| PREDICTED: glutathione S-t ( 225) 259 71.6 7.1e-10 ref|XP_006194835.1| PREDICTED: glutathione S-t ( 226) 259 71.6 7.2e-10 ref|XP_970442.1| PREDICTED: glutathione S-trans ( 204) 258 71.4 7.4e-10 hypothetical protein D910_05094 [Dendroctonus pond ( 204) 258 71.4 7.4e-10 ref|XP_002630602.1| C. briggsae CBR-GST-6.1 pr ( 206) 258 71.4 7.5e-10 multivalent antigen sj23-26 [synthetic construct] ( 451) 264 72.5 7.7e-10 ref|XP_004416843.1| PREDICTED: glutathione S-t ( 210) 258 71.3 7.7e-10 ref|XP_001699219.1| glutathione S-transferase ( 214) 258 71.3 7.9e-10 ref|XP_008871728.1| hypothetical protein H310_ ( 214) 258 71.3 7.9e-10 hypothetical protein DAPPUDRAFT_230303 [Daphnia pu ( 218) 258 71.3 8.1e-10 pdb|1U87|A Chain A, Crystal Structure Of The 26 ( 218) 258 71.3 8.1e-10 Glutathione S-transferase Mu 2 [Fukomys damarensis ( 218) 258 71.3 8.1e-10 multivalent antigen sj26-FABP [synthetic construct ( 365) 262 72.1 8.1e-10 ref|XP_006260118.1| PREDICTED: glutathione S-t ( 220) 258 71.3 8.2e-10 ref|XP_002610392.1| hypothetical protein BRAFL ( 197) 257 71.1 8.4e-10 multivalent antigen sjTPI-26 [synthetic construct] ( 485) 264 72.4 8.4e-10 ref|XP_004420766.1| PREDICTED: glutathione S-t ( 226) 258 71.3 8.5e-10 ref|XP_005076669.1| PREDICTED: glutathione S-t ( 226) 258 71.3 8.5e-10 ref|XP_007900695.1| PREDICTED: hematopoietic p ( 199) 257 71.1 8.5e-10 ref|XP_003386742.1| PREDICTED: glutathione S-t ( 200) 257 71.1 8.6e-10 ref|XP_647580.1| hypothetical protein DDB_G0268 ( 202) 257 71.1 8.7e-10 ref|XP_003108960.1| CRE-GST-5 protein [Caenorh ( 205) 257 71.1 8.9e-10 Thioredoxin-like fold domain-containing protein [R ( 208) 257 71.1 9e-10 GSTmFra2/2-163 [Expression vector pGH/F2.2-163] ( 405) 262 72.0 9.3e-10 GSTmFra2/79-242 [Expression vector pGH/F2.79-242] ( 406) 262 72.0 9.4e-10 glutathione s-transferase pi, partial [Gobiocypris ( 166) 255 70.7 9.4e-10 GSTmFra2/159-327 [Expression vector pGH/F2.159-327 ( 410) 262 72.0 9.5e-10 ref|XP_004659077.1| PREDICTED: glutathione S-t ( 218) 257 71.1 9.6e-10 glutathione S-transferase mu 3 [Meleagris gallopav ( 219) 257 71.1 9.7e-10 glutathione S-transferase pi [Homo sapiens] ( 151) 254 70.5 9.8e-10 ref|XP_006092637.1| PREDICTED: glutathione S-t ( 225) 257 71.1 1e-09 ref|NP_001233497.1| glutathione S-transferase ( 225) 257 71.1 1e-09 ref|XP_004659076.1| PREDICTED: glutathione S-t ( 225) 257 71.1 1e-09 GST-(Pch PRP8 intein with linker)-6xH [Cloning vec ( 434) 262 72.0 1e-09 glutathione S-transferase [Plutella xylostella] ( 204) 256 70.9 1e-09 prostaglandin D synthase [Eriocheir sinensis] ( 204) 256 70.9 1e-09 multivalent antigen sjGAPDH-26 [synthetic construc ( 571) 264 72.4 1e-09 glutathione-S-transferase-nitroreductase B fusion ( 442) 262 72.0 1e-09 ref|NP_496863.1| Protein GST-16 [Caenorhabditis ( 208) 256 70.9 1.1e-09 ref|XP_007900694.1| PREDICTED: hematopoietic p ( 237) 257 71.0 1.1e-09 multivalent antigen sj26-23 [synthetic construct] ( 451) 262 72.0 1.1e-09 hypothetical protein CAEBREN_14956 [Caenorhabditis ( 209) 256 70.9 1.1e-09 CBN-GST-36 protein [Caenorhabditis brenneri] ( 210) 256 70.9 1.1e-09 Lasso-G [synthetic construct] ( 457) 262 72.0 1.1e-09 GST-CpxR [Cloning vector pDAL649] ( 460) 262 72.0 1.1e-09 glutathione-S-transferase/nitroreductase fusion pr ( 465) 262 72.0 1.1e-09 glutathione-S-transferase-nitroreductase A fusion ( 465) 262 72.0 1.1e-09 ref|XP_002999209.1| glutathione S-transferase, ( 602) 264 72.3 1.1e-09 sp|P46419.1|GSTM1_DERPT RecName: Full=Glutathion ( 219) 256 70.8 1.1e-09 glutathione S-transferase pi [Homo sapiens] ( 151) 253 70.3 1.2e-09 para-25kDa-like 54 kDa expressed salivary protein ( 483) 262 71.9 1.2e-09 ref|NP_034490.1| glutathione S-transferase Mu 5 ( 224) 256 70.8 1.2e-09 pdb|3GTU|B Chain B, Ligand-Free Heterodimeric Hu ( 224) 256 70.8 1.2e-09 GSTmFra2/2-242 [Expression vector pGH/F2.2-242] ( 484) 262 71.9 1.2e-09 multivalent antigen sj26-TPI [synthetic construct] ( 485) 262 71.9 1.2e-09 glutathione transferase M3 [Homo sapiens] ( 225) 256 70.8 1.2e-09 ref|XP_003267972.1| PREDICTED: glutathione S-t ( 225) 256 70.8 1.2e-09 ref|XP_005367909.1| PREDICTED: glutathione S-t ( 225) 256 70.8 1.2e-09 ref|NP_000840.2| glutathione S-transferase Mu 3 ( 225) 256 70.8 1.2e-09 GSTM3, partial [synthetic construct] ( 225) 256 70.8 1.2e-09 ref|XP_006866064.1| PREDICTED: glutathione S-t ( 226) 256 70.8 1.2e-09 ref|XP_008702251.1| PREDICTED: glutathione S-t ( 226) 256 70.8 1.2e-09 glutathione S-transferase M3 [synthetic construct] ( 226) 256 70.8 1.2e-09 GSTmFra2/79-327 [Expression vector pGH/F2.79-327] ( 490) 262 71.9 1.2e-09 ref|XP_003515285.1| PREDICTED: glutathione S-t ( 227) 256 70.8 1.2e-09 glutathione S-transferase s3 protein [Spodoptera l ( 204) 255 70.6 1.2e-09 ref|NP_494882.2| Protein GST-6 [Caenorhabditis ( 206) 255 70.6 1.3e-09 glutathione-s-transferase/NAD-dependent deacetylas ( 511) 262 71.9 1.3e-09 ref|XP_002111321.1| hypothetical protein TRIAD ( 209) 255 70.6 1.3e-09 ref|NP_497115.1| Protein GST-26 [Caenorhabditis ( 209) 255 70.6 1.3e-09 GST/EGFP fusion protein [synthetic construct] ( 518) 262 71.9 1.3e-09 ref|XP_002120061.2| PREDICTED: glutathione S-t ( 127) 251 69.9 1.3e-09 pdb|3CRT|A Chain A, Structural Characterizatio ( 214) 255 70.6 1.3e-09 ref|XP_002952421.1| hypothetical protein VOLCA ( 216) 255 70.6 1.3e-09 ref|XP_005367919.1| PREDICTED: glutathione S-t ( 218) 255 70.6 1.3e-09 ref|XP_005076676.1| PREDICTED: LOW QUALITY PRO ( 218) 255 70.6 1.3e-09 glutathione S-transferase M1 [Schistosoma japonicu ( 218) 255 70.6 1.3e-09 glutathione S transferase Mu 1 [Echinococcus granu ( 219) 255 70.6 1.4e-09 GST-GFP [Cloning vector pGEX3x] ( 539) 262 71.9 1.4e-09 ref|XP_002733919.2| PREDICTED: glutathione S-t ( 221) 255 70.6 1.4e-09 Glutathione S-transferase P [Salmo salar] ( 196) 254 70.4 1.4e-09 glutathione S-transferase [Rhipicephalus microplus ( 223) 255 70.6 1.4e-09 ref|XP_004263196.1| PREDICTED: glutathione S-t ( 225) 255 70.6 1.4e-09 ref|XP_008848592.1| PREDICTED: glutathione S-t ( 225) 255 70.6 1.4e-09 ref|NP_742035.1| glutathione S-transferase Mu 5 ( 225) 255 70.6 1.4e-09 ref|XP_006871037.1| PREDICTED: glutathione S-t ( 226) 255 70.6 1.4e-09 ref|XP_537037.1| PREDICTED: glutathione S-trans ( 226) 255 70.6 1.4e-09 ref|XP_005337614.1| PREDICTED: hematopoietic p ( 199) 254 70.4 1.4e-09 ref|XP_009009941.1| hypothetical protein HELRO ( 201) 254 70.4 1.4e-09 glutathione S-transferase sigma 3 [Cnaphalocrocis ( 203) 254 70.4 1.5e-09 putative glutathione s-transferase [Lutzomyia long ( 203) 254 70.4 1.5e-09 GSTmFra2/2-327 [Expression vector pGH/F2.2-327] ( 568) 262 71.9 1.5e-09 ref|XP_002128150.1| PREDICTED: glutathione S-t ( 204) 254 70.4 1.5e-09 glutathione S-transferase sigma 7 [Locusta migrato ( 204) 254 70.4 1.5e-09 mu-glutathione transferase, partial [Fasciola hepa ( 210) 254 70.4 1.5e-09 glutathione s-transferase [Stylonychia lemnae] ( 210) 254 70.4 1.5e-09 pdb|3D0Z|A Chain A, Structural Charcaterizatio ( 214) 254 70.4 1.6e-09 glutathione S-transferase mu class protein [Crasso ( 215) 254 70.4 1.6e-09 glutathione S transferase:ISOTYPE=GST7 ( 217) 254 70.4 1.6e-09 mCG140529, isoform CRA_b [Mus musculus] ( 194) 253 70.2 1.6e-09 Der f 8 allergen [Dermatophagoides farinae] ( 221) 254 70.3 1.6e-09 sp|P56598.2|GST29_FASHE RecName: Full=Glutathion ( 221) 254 70.3 1.6e-09 ref|XP_009167217.1| hypothetical protein T265_ ( 252) 255 70.5 1.6e-09 ref|XP_006149605.1| PREDICTED: glutathione S-t ( 224) 254 70.3 1.7e-09 ref|XP_008064841.1| PREDICTED: glutathione S-t ( 224) 254 70.3 1.7e-09 ref|XP_002810525.1| PREDICTED: glutathione S-t ( 225) 254 70.3 1.7e-09 ref|XP_004582011.1| PREDICTED: glutathione S-t ( 225) 254 70.3 1.7e-09 glutathione S-transferase mu1 [Tetranychus cinnaba ( 225) 254 70.3 1.7e-09 glutathione S-transferase M3 [synthetic construct] ( 226) 254 70.3 1.7e-09 ref|XP_003990462.1| PREDICTED: glutathione S-t ( 226) 254 70.3 1.7e-09 ref|XP_007076475.1| PREDICTED: glutathione S-t ( 226) 254 70.3 1.7e-09 ref|XP_008053018.1| PREDICTED: hematopoietic p ( 199) 253 70.2 1.7e-09 ref|XP_004902288.1| PREDICTED: hematopoietic p ( 199) 253 70.2 1.7e-09 ref|XP_004448999.1| PREDICTED: glutathione S-t ( 227) 254 70.3 1.7e-09 ref|XP_002999208.1| glutathione S-transferase, ( 200) 253 70.1 1.7e-09 ref|XP_008892225.1| hypothetical protein PPTG_ ( 200) 253 70.1 1.7e-09 ref|XP_004852279.1| PREDICTED: glutathione S-t ( 335) 257 70.9 1.7e-09 ref|XP_003395150.1| PREDICTED: glutathione S-t ( 201) 253 70.1 1.7e-09 Glutathione S-transferase, putative [Oxytricha tri ( 337) 257 70.9 1.7e-09 ref|XP_002608095.1| hypothetical protein BRAFL ( 202) 253 70.1 1.7e-09 ref|NP_508625.1| Protein GST-11 [Caenorhabditis ( 203) 253 70.1 1.7e-09 ref|XP_002644402.1| C. briggsae CBR-GST-11 pro ( 204) 253 70.1 1.7e-09 GST-(Pch PRP8 intein with SpHis5)-6xH [Cloning vec ( 648) 262 71.8 1.7e-09 sp|P26624.1|GST28_SCHJA RecName: Full=Glutathione ( 206) 253 70.1 1.8e-09 hypothetical protein CAEBREN_32554 [Caenorhabditis ( 207) 253 70.1 1.8e-09 GST-M.SPRX methyltransferase fusion protein [Mutat ( 659) 262 71.8 1.8e-09 ref|WP_018050658.1| hypothetical protein [SAR3 ( 208) 253 70.1 1.8e-09 ref|XP_002631507.1| C. briggsae CBR-GST-20 pro ( 208) 253 70.1 1.8e-09 hypothetical protein CAEBREN_25437 [Caenorhabditis ( 209) 253 70.1 1.8e-09 ref|XP_003102586.1| CRE-GST-36 protein [Caenor ( 210) 253 70.1 1.8e-09 ref|XP_003102789.1| CRE-GST-2 protein [Caenorh ( 272) 255 70.5 1.8e-09 ref|XP_003395151.1| PREDICTED: glutathione S-t ( 211) 253 70.1 1.8e-09 glutathione S-transferase [Schistosoma japonicum] ( 211) 253 70.1 1.8e-09 glutathione s-transferase [Stylonychia lemnae] ( 212) 253 70.1 1.8e-09 glutathione S-transferase 2 [Laminaria digitata] ( 212) 253 70.1 1.8e-09 hypothetical protein DAPPUDRAFT_305501 [Daphnia pu ( 217) 253 70.1 1.9e-09 ref|XP_003514992.1| PREDICTED: glutathione S-t ( 218) 253 70.1 1.9e-09 glutathione transferase mu class Dp7019C10 [Dermat ( 219) 253 70.1 1.9e-09 ref|XP_003769789.1| PREDICTED: glutathione S-t ( 220) 253 70.1 1.9e-09 GST-(Pch PRP8 intein with G418r)-6xH [Cloning vect ( 700) 262 71.8 1.9e-09 ref|XP_002783353.1| Glutathione S-transferase, ( 224) 253 70.1 2e-09 ref|XP_004898473.1| PREDICTED: glutathione S-t ( 225) 253 70.1 2e-09 ref|XP_004636967.1| PREDICTED: glutathione S-t ( 225) 253 70.1 2e-09 Hematopoietic prostaglandin D synthase [Caprimulgu ( 199) 252 69.9 2e-09 ref|XP_003205530.1| PREDICTED: hematopoietic p ( 199) 252 69.9 2e-09 Bla g 5 variant allergen [Blattella germanica] ( 200) 252 69.9 2e-09 GST-(Pch PRP8 intein with LexA::VP16)-6xH [Cloning ( 726) 262 71.8 2e-09 glutathione S-transferase sigma 2 [Locusta migrato ( 204) 252 69.9 2.1e-09 glutathione S-transferase sigma 1 [Mytilus gallopr ( 204) 252 69.9 2.1e-09 hypothetical protein CAEBREN_01610 [Caenorhabditis ( 207) 252 69.9 2.1e-09 ref|XP_002143279.1| glutathione S-transferase, ( 208) 252 69.9 2.1e-09 ref|XP_002647337.1| Hypothetical protein CBG06 ( 209) 252 69.9 2.1e-09 Glutathione S-Transferase [Schistosoma japonicum] ( 211) 252 69.9 2.2e-09 Glutathione S-Transferase [Schistosoma japonicum] ( 211) 252 69.9 2.2e-09 Glutathione S-Transferase [Schistosoma japonicum] ( 211) 252 69.9 2.2e-09 glutathione S-transferase protein [Necator america ( 456) 258 71.0 2.2e-09 ref|XP_005973631.1| PREDICTED: glutathione S-t ( 212) 252 69.9 2.2e-09 GST-(Pch PRP8 intein with HYGr)-6xH [Cloning vecto ( 773) 262 71.7 2.2e-09 mu glutathione S-transferase [Ruditapes philippina ( 217) 252 69.9 2.2e-09 ref|XP_009095569.1| PREDICTED: glutathione S-t ( 219) 252 69.9 2.3e-09 Glutathione S-transferase Mu 5 [Heterocephalus gla ( 219) 252 69.9 2.3e-09 ref|XP_004070446.1| PREDICTED: glutathione S-t ( 219) 252 69.9 2.3e-09 ref|XP_005663640.1| PREDICTED: glutathione S-t ( 222) 252 69.9 2.3e-09 ref|XP_002783354.1| Glutathione S-transferase, ( 224) 252 69.9 2.3e-09 ref|XP_007529411.1| PREDICTED: glutathione S-t ( 225) 252 69.8 2.3e-09 ref|XP_006919673.1| PREDICTED: glutathione S-t ( 226) 252 69.8 2.4e-09 ref|XP_003929592.1| PREDICTED: hematopoietic p ( 199) 251 69.7 2.4e-09 ref|XP_004852277.1| PREDICTED: glutathione S-t ( 432) 257 70.8 2.4e-09 Epidermal growth factor receptor kinase substrate ( 724) 261 71.5 2.4e-09 hypothetical protein CAEBREN_15068 [Caenorhabditis ( 204) 251 69.6 2.4e-09 glutathione S-transferase GSTX01 [Helicoverpa armi ( 206) 251 69.6 2.5e-09 ref|XP_003492280.1| PREDICTED: glutathione S-t ( 207) 251 69.6 2.5e-09 pdb|1YQ1|A Chain A, Structural Genomics Of Caen ( 208) 251 69.6 2.5e-09 multivalent antigen sj97-26 [synthetic construct] (1104) 264 72.0 2.5e-09 glutathione S-transferase A3-3 [Canis lupus famili ( 45) 239 67.4 2.5e-09 artificial protein [Artificial vector pGEX-2T] ( 864) 262 71.7 2.5e-09 Glutathione S-Transferase [Schistosoma japonicum] ( 211) 251 69.6 2.5e-09 pdb|4L5O|A Chain A, Crystal Structure Of 26 Kd ( 218) 251 69.6 2.7e-09 pdb|3ISO|A Chain A, Crystal Structure Of 26 Kd ( 218) 251 69.6 2.7e-09 ref|XP_003479255.1| PREDICTED: glutathione S-t ( 218) 251 69.6 2.7e-09 ref|XP_004636970.1| PREDICTED: glutathione S-t ( 218) 251 69.6 2.7e-09 ref|XP_007570972.1| PREDICTED: glutathione S-t ( 219) 251 69.6 2.7e-09 glutathione S-transferase M3 [synthetic construct] ( 226) 251 69.6 2.8e-09 ref|XP_002745628.1| PREDICTED: hematopoietic p ( 199) 250 69.4 2.8e-09 ref|NP_113832.1| hematopoietic prostaglandin D ( 199) 250 69.4 2.8e-09 ref|XP_006020111.1| PREDICTED: hematopoietic p ( 199) 250 69.4 2.8e-09 glutathione S transferase-1 [Schmidtea mediterrane ( 200) 250 69.4 2.8e-09 ref|XP_009009939.1| hypothetical protein HELRO ( 201) 250 69.4 2.8e-09 glutathione S-transferase mu class 1 [Sarcoptes sc ( 201) 250 69.4 2.8e-09 hypothetical protein YQE_07672, partial [Dendrocto ( 204) 250 69.4 2.9e-09 ref|NP_001156113.1| glutathione S-transferase- ( 204) 250 69.4 2.9e-09 ref|XP_002118594.1| hypothetical protein TRIAD ( 208) 250 69.4 3e-09 glutathione s [Nannochloropsis gaditana] ( 269) 252 69.8 3e-09 ref|XP_002635678.1| C. briggsae CBR-GST-33 pro ( 213) 250 69.4 3.1e-09 26 Kd glutathione-S-transferase, Sm26, putative [S ( 218) 250 69.4 3.2e-09 ref|XP_005530282.1| PREDICTED: glutathione S-t ( 219) 250 69.4 3.2e-09 Glutathione-requiring prostaglandin D synthase, pa ( 197) 249 69.2 3.3e-09 ref|XP_002783348.1| Glutathione S-transferase, ( 224) 250 69.4 3.3e-09 ref|XP_002751233.1| PREDICTED: glutathione S-t ( 225) 250 69.4 3.3e-09 ref|XP_008842842.1| PREDICTED: hematopoietic p ( 199) 249 69.2 3.3e-09 ref|XP_005024474.1| PREDICTED: hematopoietic p ( 199) 249 69.2 3.3e-09 ref|XP_008605655.1| hypothetical protein SDRG_ ( 202) 249 69.2 3.4e-09 ref|XP_008892226.1| hypothetical protein PPTG_ ( 230) 250 69.3 3.4e-09 ref|XP_003118478.1| CRE-GST-11 protein [Caenor ( 204) 249 69.2 3.4e-09 sigma glutathione S-transferase [Locusta migratori ( 204) 249 69.2 3.4e-09 glutathione-requiring prostaglandin D synthase [He ( 206) 249 69.2 3.5e-09 multivalent antigen sj26-97 [synthetic construct] (1104) 262 71.6 3.5e-09 hypothetical protein CAEBREN_13564 [Caenorhabditis ( 209) 249 69.1 3.5e-09 mu class glutathione S-transferase [Crassostrea gi ( 215) 249 69.1 3.7e-09 Protein dispatched-2 [Strongyloides ratti] (1155) 262 71.5 3.7e-09 ref|NP_001080840.1| glutathione S-transferase ( 219) 249 69.1 3.8e-09 glutathione S-transferase [Rhipicephalus microplus ( 220) 249 69.1 3.8e-09 GST class mu [Hymenolepis microstoma] ( 221) 249 69.1 3.8e-09 glutathione S-transferase 1 [Spirometra erinaceieu ( 221) 249 69.1 3.8e-09 ref|XP_005338164.1| PREDICTED: glutathione S-t ( 225) 249 69.1 3.9e-09 ref|XP_003933464.1| PREDICTED: glutathione S-t ( 225) 249 69.1 3.9e-09 ref|XP_003492442.1| PREDICTED: glutathione S-t ( 226) 249 69.1 3.9e-09 ref|XP_003357127.1| PREDICTED: hematopoietic p ( 199) 248 68.9 3.9e-09 ref|NP_055300.1| hematopoietic prostaglandin D s ( 199) 248 68.9 3.9e-09 Hematopoietic prostaglandin D synthase [Tauraco er ( 199) 248 68.9 3.9e-09 ref|XP_002815022.1| PREDICTED: hematopoietic p ( 199) 248 68.9 3.9e-09 pdb|4EDZ|A Chain A, Crystal Structure Of Hh-Pg ( 199) 248 68.9 3.9e-09 pdb|4EE0|A Chain A, Crystal Structure Of Hh-Pg ( 199) 248 68.9 3.9e-09 pdb|4EC0|A Chain A, Crystal Structure Of Hh-Pg ( 200) 248 68.9 3.9e-09 prostaglandin D2 synthase [synthetic construct] ( 200) 248 68.9 3.9e-09 pdb|3KXO|A Chain A, An Orally Active Inhibitor ( 202) 248 68.9 4e-09 S-crystallin SL11 [Crassostrea gigas] ( 204) 248 68.9 4.1e-09 ref|XP_969146.1| PREDICTED: glutathione S-trans ( 204) 248 68.9 4.1e-09 glutathione S-transferase 1 [Laminaria digitata] ( 205) 248 68.9 4.1e-09 unknown [Dendroctonus ponderosae] ( 205) 248 68.9 4.1e-09 hypothetical protein CAPTEDRAFT_169414 [Capitella ( 206) 248 68.9 4.1e-09 glutathione S-transferase [Haliotis diversicolor] ( 208) 248 68.9 4.2e-09 ref|NP_496862.1| Protein GST-12 [Caenorhabditis ( 209) 248 68.9 4.2e-09 Glutathione S-Transferase [Schistosoma japonicum] ( 211) 248 68.9 4.2e-09 glutathione S-transferase [Paragonimus westermani] ( 217) 248 68.9 4.4e-09 ref|NP_741061.2| Protein GST-35 [Caenorhabditis ( 218) 248 68.9 4.4e-09 ref|XP_003409600.1| PREDICTED: glutathione S-t ( 218) 248 68.9 4.4e-09 hypothetical protein DAPPUDRAFT_230650 [Daphnia pu ( 218) 248 68.9 4.4e-09 ref|XP_005104565.1| PREDICTED: glutathione S-t ( 192) 247 68.7 4.4e-09 hypothetical protein PPL_00872 [Polysphondylium pa ( 169) 246 68.5 4.4e-09 ref|XP_006823789.1| PREDICTED: glutathione S-t ( 149) 245 68.3 4.4e-09 ref|XP_002919260.1| PREDICTED: glutathione S-t ( 226) 248 68.9 4.6e-09 ref|XP_001163736.1| PREDICTED: hematopoietic p ( 199) 247 68.7 4.6e-09 ref|XP_004590684.1| PREDICTED: hematopoietic p ( 199) 247 68.7 4.6e-09 Hematopoietic prostaglandin D synthase [Phaethon l ( 199) 247 68.7 4.6e-09 Hematopoietic prostaglandin D synthase [Cariama cr ( 199) 247 68.7 4.6e-09 ref|XP_008639543.1| PREDICTED: hematopoietic p ( 199) 247 68.7 4.6e-09 hypothetical protein TcasGA2_TC003232 [Tribolium c ( 202) 247 68.7 4.7e-09 ref|XP_008605656.1| hypothetical protein SDRG_ ( 202) 247 68.7 4.7e-09 glutathione S-transferase [Bemisia tabaci] ( 203) 247 68.7 4.8e-09 glutathione S-transferase [Helicoverpa armigera] ( 206) 247 68.7 4.9e-09 glutathione S-transferase [Helicoverpa armigera] ( 206) 247 68.7 4.9e-09 ref|XP_001637390.1| predicted protein [Nematos ( 208) 247 68.7 4.9e-09 Glutathione S-Transferase [Schistosoma japonicum] ( 211) 247 68.7 5e-09 ref|XP_005706383.1| glutathione S-transferase ( 213) 247 68.7 5.1e-09 ref|XP_008262951.1| PREDICTED: glutathione S-t ( 218) 247 68.6 5.2e-09 glutathione S-transferase [Litopenaeus vannamei] ( 219) 247 68.6 5.3e-09 glutathione S-transferase [Xenopus laevis] ( 219) 247 68.6 5.3e-09 mCG144941 [Mus musculus] ( 224) 247 68.6 5.4e-09 ref|XP_006742868.1| PREDICTED: glutathione S-t ( 226) 247 68.6 5.5e-09 ref|XP_004407230.1| PREDICTED: glutathione S-t ( 226) 247 68.6 5.5e-09 ref|XP_006899376.1| PREDICTED: glutathione S-t ( 226) 247 68.6 5.5e-09 allergen Bla g 5, partial [Blattella germanica] ( 200) 246 68.4 5.5e-09 sp|O18598.3|GST1_BLAGE RecName: Full=Glutathione ( 204) 246 68.4 5.7e-09 glutathione S-transferase sigma 4 [Locusta migrato ( 204) 246 68.4 5.7e-09 S-crystallin [Doryteuthis opalescens] ( 205) 246 68.4 5.7e-09 ref|XP_005113022.1| PREDICTED: glutathione S-t ( 205) 246 68.4 5.7e-09 hypothetical protein D910_03052, partial [Dendroct ( 268) 248 68.8 5.8e-09 Glutathione S-transferase [Acromyrmex echinatior] ( 208) 246 68.4 5.8e-09 TPA: glutathione S-transferase mu 3 [Bos taurus] ( 209) 246 68.4 5.9e-09 Glutathione S-transferase [Oxytricha trifallax] ( 213) 246 68.4 6e-09 glutathione S transferase [Hymenolepis microstoma] ( 216) 246 68.4 6.1e-09 Glutathione S-transferase Mu 2 [Fukomys damarensis ( 218) 246 68.4 6.2e-09 ref|XP_002119149.2| PREDICTED: hematopoietic p ( 218) 246 68.4 6.2e-09 sp|P15964.1|GST26_SCHMA RecName: Full=Glutathione ( 218) 246 68.4 6.2e-09 ref|XP_008411538.1| PREDICTED: glutathione S-t ( 285) 248 68.8 6.3e-09 ref|XP_003784104.1| PREDICTED: glutathione S-t ( 225) 246 68.4 6.5e-09 Glutathione S-transferase Mu 3 [Fukomys damarensis ( 225) 246 68.4 6.5e-09 ref|XP_004026330.1| PREDICTED: glutathione S-t ( 225) 246 68.4 6.5e-09 ref|XP_003409443.1| PREDICTED: glutathione S-t ( 332) 249 68.9 6.5e-09 Glutathione-requiring prostaglandin D synthase [Co ( 199) 245 68.2 6.5e-09 ref|XP_003829953.1| PREDICTED: hematopoietic p ( 199) 245 68.2 6.5e-09 ref|XP_001509662.2| PREDICTED: hematopoietic p ( 199) 245 68.2 6.5e-09 ref|XP_006986782.1| PREDICTED: hematopoietic p ( 199) 245 68.2 6.5e-09 ref|XP_004039183.1| PREDICTED: hematopoietic p ( 199) 245 68.2 6.5e-09 ref|NP_001181141.1| hematopoietic prostaglandi ( 199) 245 68.2 6.5e-09 ref|XP_002717030.1| PREDICTED: hematopoietic p ( 199) 245 68.2 6.5e-09 ref|NP_001165920.1| glutathione S-transferase ( 202) 245 68.2 6.7e-09 ref|XP_800683.3| PREDICTED: S-crystallin 2-lik ( 204) 245 68.2 6.7e-09 glutathione S-transferase sigma 1 [Locusta migrato ( 204) 245 68.2 6.7e-09 glutathione S-transferase 4 [Choristoneura fumifer ( 204) 245 68.2 6.7e-09 hypothetical protein CAEBREN_30187 [Caenorhabditis ( 181) 244 68.0 6.8e-09 glutathione S-transferase [Helicoverpa armigera] ( 206) 245 68.2 6.8e-09 ref|XP_005111882.1| PREDICTED: S-crystallin SL ( 267) 247 68.5 6.9e-09 ref|XP_009057951.1| hypothetical protein LOTGI ( 208) 245 68.2 6.9e-09 hypothetical protein CAPTEDRAFT_165166 [Capitella ( 209) 245 68.2 7e-09 prostaglandin D2 synthase-like protein [Daphnia pu ( 210) 245 68.2 7e-09 Glutathione S-transferase [Oxytricha trifallax] ( 210) 245 68.2 7e-09 ref|XP_785905.1| PREDICTED: glutathione S-trans ( 213) 245 68.2 7.1e-09 ref|XP_005836707.1| hypothetical protein GUITH ( 276) 247 68.5 7.2e-09 ref|NP_001072152.1| glutathione S-transferase ( 218) 245 68.2 7.4e-09 ref|XP_008702249.1| PREDICTED: glutathione S-t ( 218) 245 68.2 7.4e-09 ref|XP_006260117.1| PREDICTED: glutathione S-t ( 220) 245 68.1 7.4e-09 ref|XP_006034418.1| PREDICTED: glutathione S-t ( 224) 245 68.1 7.6e-09 glutathione S-transferase mu 3 [synthetic construc ( 225) 245 68.1 7.7e-09 Hematopoietic prostaglandin D synthase [Apaloderma ( 199) 244 67.9 7.7e-09 ref|XP_006265325.1| PREDICTED: hematopoietic p ( 199) 244 67.9 7.7e-09 ref|XP_006209020.1| PREDICTED: hematopoietic p ( 199) 244 67.9 7.7e-09 ref|XP_002688181.1| PREDICTED: hematopoietic p ( 199) 244 67.9 7.7e-09 ref|XP_001365738.1| PREDICTED: hematopoietic p ( 199) 244 67.9 7.7e-09 ref|XP_005517524.1| PREDICTED: hematopoietic p ( 199) 244 67.9 7.7e-09 Hematopoietic prostaglandin D synthase [Gavia stel ( 199) 244 67.9 7.7e-09 ref|XP_007997481.1| PREDICTED: hematopoietic p ( 199) 244 67.9 7.7e-09 ref|XP_005498086.1| PREDICTED: hematopoietic p ( 228) 245 68.1 7.8e-09 ref|XP_003294798.1| hypothetical protein DICPU ( 202) 244 67.9 7.9e-09 glutathione S-transferase M3 variant [Homo sapiens ( 231) 245 68.1 7.9e-09 GST3 [Azumapecten farreri] ( 205) 244 67.9 8e-09 ref|XP_004341972.1| Glutathione Stransferase [ ( 234) 245 68.1 8.1e-09 ref|XP_005555510.1| PREDICTED: hematopoietic p ( 234) 245 68.1 8.1e-09 ref|XP_003395075.1| PREDICTED: glutathione S-t ( 207) 244 67.9 8.1e-09 ref|XP_003108971.1| CRE-GST-24 protein [Caenor ( 210) 244 67.9 8.3e-09 ref|XP_007495790.1| PREDICTED: hematopoietic p ( 211) 244 67.9 8.3e-09 glutathione S-transferase M2 [Macaca mulatta] ( 218) 244 67.9 8.7e-09 ref|NP_001248580.1| glutathione S-transferase ( 218) 244 67.9 8.7e-09 ref|NP_065415.1| glutathione S-transferase Mu 3 ( 218) 244 67.9 8.7e-09 rCG28672, isoform CRA_a [Rattus norvegicus] ( 218) 244 67.9 8.7e-09 glutathione transferase M2 [Macaca fuscata] ( 221) 244 67.9 8.9e-09 hypothetical protein PPL_01379 [Polysphondylium pa ( 197) 243 67.7 9e-09 ref|XP_003291696.1| hypothetical protein DICPU ( 197) 243 67.7 9e-09 ref|XP_003479260.1| PREDICTED: glutathione S-t ( 225) 244 67.9 9.1e-09 ref|XP_004769774.1| PREDICTED: glutathione S-t ( 226) 244 67.9 9.1e-09 ref|XP_005555509.1| PREDICTED: hematopoietic p ( 257) 245 68.1 9.1e-09 ref|XP_003257577.1| PREDICTED: hematopoietic p ( 199) 243 67.7 9.2e-09 Hematopoietic prostaglandin D synthase [Struthio c ( 199) 243 67.7 9.2e-09 glutathione transferase [Platynota idaeusalis] ( 202) 243 67.7 9.3e-09 glutathione s-transferase S2 [Nilaparvata lugens] ( 202) 243 67.7 9.3e-09 glutathione s-transferase-like protein [Phlebotomu ( 203) 243 67.7 9.4e-09 glutathione S-transferase family member gst-6 [Bra ( 210) 243 67.7 9.8e-09 ref|XP_005076670.1| PREDICTED: glutathione S-t ( 218) 243 67.7 1e-08 ref|NP_034489.1| glutathione S-transferase Mu 3 ( 218) 243 67.7 1e-08 glutathione S-transferase mu [Kryptolebias marmora ( 219) 243 67.7 1e-08 ref|XP_006034419.1| PREDICTED: glutathione S-t ( 220) 243 67.7 1e-08 mCG131602, isoform CRA_b [Mus musculus] ( 223) 243 67.7 1.1e-08 ref|XP_003892393.1| PREDICTED: glutathione S-t ( 225) 243 67.6 1.1e-08 Glutathione S-transferase Mu 5 [Bos mutus] ( 226) 243 67.6 1.1e-08 ref|XP_003985210.1| PREDICTED: hematopoietic p ( 199) 242 67.5 1.1e-08 ref|XP_006112012.1| PREDICTED: hematopoietic p ( 199) 242 67.5 1.1e-08 Hematopoietic prostaglandin D synthase [Cathartes ( 199) 242 67.5 1.1e-08 Hematopoietic prostaglandin D synthase [Opisthocom ( 199) 242 67.5 1.1e-08 Hematopoietic prostaglandin D synthase [Nestor not ( 199) 242 67.5 1.1e-08 ref|XP_006092638.1| PREDICTED: glutathione S-t ( 227) 243 67.6 1.1e-08 hypothetical protein TcasGA2_TC003231 [Tribolium c ( 203) 242 67.5 1.1e-08 ref|XP_001185610.2| PREDICTED: glutathione S-t ( 180) 241 67.3 1.1e-08 ref|XP_008729905.1| hypothetical protein G647_ ( 205) 242 67.4 1.1e-08 pdb|4AI6|A Chain A, Dynein Motor Domain - Adp (2695) 262 71.1 1.1e-08 ref|XP_007740741.1| hypothetical protein A1O5_ ( 207) 242 67.4 1.1e-08 ref|NP_499006.1| Protein GST-1 [Caenorhabditis ( 208) 242 67.4 1.1e-08 ref|XP_970647.2| PREDICTED: uncharacterized pr ( 404) 247 68.4 1.2e-08 Glutathione S-transferase Mu 3 [Lepeophtheirus sal ( 217) 242 67.4 1.2e-08 ref|XP_004636968.1| PREDICTED: glutathione S-t ( 218) 242 67.4 1.2e-08 ref|XP_004636972.1| PREDICTED: glutathione S-t ( 218) 242 67.4 1.2e-08 glutathione S-transferase mu [Cyprinus carpio] ( 219) 242 67.4 1.2e-08 hypothetical protein YQE_03117, partial [Dendrocto ( 171) 240 67.0 1.2e-08 glutathione S-transferase, partial [Dermatophagoid ( 197) 241 67.2 1.3e-08 ref|XP_002783349.1| Glutathione S-transferase, ( 224) 242 67.4 1.3e-08 ref|NP_001248509.1| glutathione S-transferase ( 225) 242 67.4 1.3e-08 Hematopoietic prostaglandin D synthase [Eurypyga h ( 199) 241 67.2 1.3e-08 ref|XP_005443891.1| PREDICTED: hematopoietic p ( 199) 241 67.2 1.3e-08 ref|XP_006192337.1| PREDICTED: hematopoietic p ( 199) 241 67.2 1.3e-08 Hematopoietic prostaglandin D synthase [Chaetura p ( 199) 241 67.2 1.3e-08 ref|XP_008923900.1| PREDICTED: hematopoietic p ( 199) 241 67.2 1.3e-08 ref|XP_007524604.1| PREDICTED: hematopoietic p ( 199) 241 67.2 1.3e-08 ref|XP_005610418.1| PREDICTED: glutathione S-t ( 231) 242 67.4 1.3e-08 glutathione S-transferase [Chironomus tentans] ( 205) 241 67.2 1.3e-08 ref|XP_795664.1| PREDICTED: S-crystallin 4-like ( 208) 241 67.2 1.4e-08 GST-loxP-cre recombinase fusion protein [Retrofitt ( 600) 249 68.7 1.4e-08 ref|XP_003769788.1| PREDICTED: glutathione S-t ( 217) 241 67.2 1.4e-08 ref|XP_003919635.1| PREDICTED: LOW QUALITY PRO ( 217) 241 67.2 1.4e-08 ref|NP_001127487.1| glutathione S-transferase ( 218) 241 67.2 1.4e-08 ref|XP_007629513.1| PREDICTED: glutathione S-t ( 218) 241 67.2 1.4e-08 ref|XP_004582212.1| PREDICTED: glutathione S-t ( 218) 241 67.2 1.4e-08 glutathione S-transferase 2 [Ixodes pacificus] ( 220) 241 67.2 1.5e-08 glutathione S-transferase mu4 [Tigriopus japonicus ( 221) 241 67.2 1.5e-08 ref|XP_005418191.1| PREDICTED: hematopoietic p ( 199) 240 67.0 1.5e-08 ref|XP_006076597.1| PREDICTED: hematopoietic p ( 199) 240 67.0 1.5e-08 ref|XP_005232584.1| PREDICTED: hematopoietic p ( 199) 240 67.0 1.5e-08 ref|XP_004391564.1| PREDICTED: hematopoietic p ( 199) 240 67.0 1.5e-08 hypothetical protein PHYSODRAFT_353862 [Phytophtho ( 200) 240 67.0 1.5e-08 ref|XP_006236664.1| PREDICTED: hematopoietic p ( 200) 240 67.0 1.5e-08 glutathione S-transferase [Dreissena polymorpha] ( 205) 240 67.0 1.6e-08 glutathione S-transferase [Helicoverpa armigera] ( 206) 240 67.0 1.6e-08 hypothetical protein CAPTEDRAFT_152307 [Capitella ( 209) 240 66.9 1.6e-08 ref|NP_496861.1| Protein GST-14 [Caenorhabditis ( 210) 240 66.9 1.6e-08 ref|NP_001166305.1| glutathione S-transferase ( 218) 240 66.9 1.7e-08 ref|XP_007975861.1| PREDICTED: glutathione S-t ( 218) 240 66.9 1.7e-08 ref|XP_006197481.1| PREDICTED: glutathione S-t ( 218) 240 66.9 1.7e-08 ref|XP_001429999.1| hypothetical protein [Para ( 218) 240 66.9 1.7e-08 ref|NP_787019.1| glutathione S-transferase Mu 1 ( 218) 240 66.9 1.7e-08 glutathione S-transferase pi, isoform CRA_c, parti ( 173) 238 66.5 1.8e-08 pdb|1IYH|A Chain A, Crystal Structure Of Hemato ( 198) 239 66.7 1.8e-08 ref|XP_004332896.1| glutathione Stransferase, ( 226) 240 66.9 1.8e-08 ref|XP_006910800.1| PREDICTED: hematopoietic p ( 199) 239 66.7 1.8e-08 Hematopoietic prostaglandin D synthase [Buceros rh ( 199) 239 66.7 1.8e-08 ref|XP_004681171.1| PREDICTED: hematopoietic p ( 199) 239 66.7 1.8e-08 Hematopoietic prostaglandin D synthase [Haliaeetus ( 199) 239 66.7 1.8e-08 ref|XP_002774488.1| glutathione s-transferase, ( 106) 234 65.8 1.8e-08 ref|XP_004360217.1| hypothetical protein DFA_0 ( 202) 239 66.7 1.8e-08 ref|XP_001661869.1| glutathione s-transferase ( 203) 239 66.7 1.9e-08 AAEL011741-PB [Aedes aegypti] ( 203) 239 66.7 1.9e-08 Glutathione S-transferase [Schistocerca gregaria] ( 204) 239 66.7 1.9e-08 ref|XP_641371.1| hypothetical protein DDB_G0280 ( 204) 239 66.7 1.9e-08 multivalent antigen sj26-GAPDH [synthetic construc ( 571) 247 68.2 1.9e-08 ref|XP_003727717.1| PREDICTED: S-crystallin SL ( 210) 239 66.7 1.9e-08 ref|XP_003728861.1| PREDICTED: glutathione S-t ( 213) 239 66.7 2e-08 Glutathione S-transferase P 1 [Salmo salar] ( 145) 236 66.1 2e-08 Glutathione S-transferase Mu 3 [Caligus clemensi] ( 217) 239 66.7 2e-08 ref|XP_005388944.1| PREDICTED: glutathione S-t ( 218) 239 66.7 2e-08 ref|XP_003514989.1| PREDICTED: glutathione S-t ( 218) 239 66.7 2e-08 ref|XP_004898468.1| PREDICTED: glutathione S-t ( 218) 239 66.7 2e-08 ref|NP_997841.1| glutathione S-transferase M [D ( 219) 239 66.7 2e-08 ref|XP_008550573.1| PREDICTED: glutathione S-t ( 367) 243 67.4 2.1e-08 ref|XP_003220236.1| PREDICTED: glutathione S-t ( 220) 239 66.7 2.1e-08 ref|XP_009009942.1| hypothetical protein HELRO ( 199) 238 66.5 2.1e-08 ref|XP_004756110.1| PREDICTED: hematopoietic p ( 199) 238 66.5 2.1e-08 Hematopoietic prostaglandin D synthase [Phoenicopt ( 199) 238 66.5 2.1e-08 hypothetical protein PHYSODRAFT_353859 [Phytophtho ( 200) 238 66.5 2.2e-08 ref|WP_012831164.1| glutathione S-transferase ( 228) 239 66.7 2.2e-08 ref|XP_003950911.1| PREDICTED: glutathione S-t ( 93) 232 65.4 2.2e-08 ref|XP_003386761.1| PREDICTED: glutathione S-t ( 203) 238 66.5 2.2e-08 Glutathione S-transferase [Ectocarpus siliculosus] ( 206) 238 66.5 2.2e-08 ref|XP_001186766.2| PREDICTED: glutathione S-t ( 213) 238 66.4 2.3e-08 ref|XP_002715838.2| PREDICTED: glutathione S-t ( 279) 240 66.8 2.4e-08 pdb|1HNB|A Chain A, Crystal Structure Of Human Cl ( 217) 238 66.4 2.4e-08 pdb|1B4P|A Chain A, Crystal Structures Of Class ( 217) 238 66.4 2.4e-08 pdb|2GTU|A Chain A, Ligand-Free Human Glutathion ( 217) 238 66.4 2.4e-08 pdb|2C4J|A Chain A, Human Glutathione-S-Transfe ( 218) 238 66.4 2.4e-08 ref|XP_006065038.1| PREDICTED: glutathione S-t ( 218) 238 66.4 2.4e-08 ref|XP_007427589.1| PREDICTED: glutathione S-t ( 218) 238 66.4 2.4e-08 ref|NP_000839.1| glutathione S-transferase Mu 2 ( 218) 238 66.4 2.4e-08 ref|NP_001103586.1| glutathione S-transferase ( 219) 238 66.4 2.4e-08 glutathione S-transferase M2 [synthetic construct] ( 219) 238 66.4 2.4e-08 glutathione S-transferase mu3 [Panonychus citri] ( 222) 238 66.4 2.5e-08 Hematopoietic prostaglandin D synthase [Balearica ( 199) 237 66.2 2.5e-08 Hematopoietic prostaglandin D synthase [Cuculus ca ( 199) 237 66.2 2.5e-08 ref|XP_008497828.1| PREDICTED: hematopoietic p ( 199) 237 66.2 2.5e-08 ref|XP_004658616.1| PREDICTED: hematopoietic p ( 199) 237 66.2 2.5e-08 ref|XP_005484669.1| PREDICTED: hematopoietic p ( 199) 237 66.2 2.5e-08 glutathione S transferase S1 [Papilio xuthus] ( 203) 237 66.2 2.6e-08 ref|XP_007298468.1| glutathione S-transferase- ( 231) 238 66.4 2.6e-08 glutathione s-transferase [Stylonychia lemnae] ( 209) 237 66.2 2.7e-08 ref|XP_005099088.1| PREDICTED: probable glutat ( 162) 235 65.8 2.7e-08 ref|XP_008064840.1| PREDICTED: glutathione S-t ( 218) 237 66.2 2.9e-08 ref|XP_004420771.1| PREDICTED: glutathione S-t ( 218) 237 66.2 2.9e-08 unnamed protein product [Tetraodon nigroviridis] ( 219) 237 66.2 2.9e-08 ref|XP_007570968.1| PREDICTED: glutathione S-t ( 220) 237 66.2 2.9e-08 Glutathione-requiring prostaglandin D synthase [Pt ( 287) 239 66.6 2.9e-08 ref|XP_006815126.1| PREDICTED: glutathione S-t ( 327) 240 66.7 2.9e-08 ref|XP_005610417.1| PREDICTED: glutathione S-t ( 225) 237 66.2 3e-08 ref|XP_008564868.1| PREDICTED: glutathione S-t ( 226) 237 66.2 3e-08 ref|XP_002193515.1| PREDICTED: hematopoietic p ( 199) 236 66.0 3e-08 ref|XP_005148720.1| PREDICTED: hematopoietic p ( 199) 236 66.0 3e-08 Hematopoietic prostaglandin D synthase [Tyto alba] ( 199) 236 66.0 3e-08 ref|XP_008576077.1| PREDICTED: hematopoietic p ( 199) 236 66.0 3e-08 ref|XP_003498946.1| PREDICTED: hematopoietic p ( 199) 236 66.0 3e-08 ref|XP_008705383.1| PREDICTED: hematopoietic p ( 199) 236 66.0 3e-08 ref|XP_002915332.1| PREDICTED: hematopoietic p ( 199) 236 66.0 3e-08 ref|XP_007074739.1| PREDICTED: hematopoietic p ( 199) 236 66.0 3e-08 ref|XP_004009749.1| PREDICTED: hematopoietic p ( 199) 236 66.0 3e-08 Hematopoietic prostaglandin D synthase [Nipponia n ( 199) 236 66.0 3e-08 ref|XP_003747949.1| PREDICTED: glutathione S-t ( 227) 237 66.2 3e-08 glutathione S-transferase sigma [Brachionus sp. 'k ( 201) 236 66.0 3e-08 ref|XP_008475194.1| PREDICTED: glutathione S-t ( 203) 236 66.0 3.1e-08 ref|XP_008475192.1| PREDICTED: glutathione S-t ( 203) 236 66.0 3.1e-08 glutathione s-transferase [Anopheles darlingi] ( 203) 236 66.0 3.1e-08 hypothetical protein SINV_80623 [Solenopsis invict ( 204) 236 66.0 3.1e-08 ref|XP_003386741.1| PREDICTED: hematopoietic p ( 204) 236 66.0 3.1e-08 ref|XP_005072484.1| PREDICTED: glutathione S-t ( 164) 234 65.6 3.3e-08 glutathione S-transferase mu, partial [Paracyclopi ( 212) 236 66.0 3.3e-08 ref|XP_005797763.1| PREDICTED: maleylacetoacet ( 216) 236 66.0 3.3e-08 ref|XP_003933467.1| PREDICTED: glutathione S-t ( 217) 236 66.0 3.4e-08 ref|XP_008848602.1| PREDICTED: glutathione S-t ( 218) 236 65.9 3.4e-08 ref|XP_002715843.1| PREDICTED: glutathione S-t ( 218) 236 65.9 3.4e-08 ref|XP_003267965.1| PREDICTED: glutathione S-t ( 218) 236 65.9 3.4e-08 ref|XP_005338159.1| PREDICTED: glutathione S-t ( 218) 236 65.9 3.4e-08 ref|XP_003784105.1| PREDICTED: glutathione S-t ( 218) 236 65.9 3.4e-08 ref|XP_009000096.1| PREDICTED: glutathione S-t ( 218) 236 65.9 3.4e-08 ref|XP_005973634.1| PREDICTED: glutathione S-t ( 218) 236 65.9 3.4e-08 ref|XP_005797762.1| PREDICTED: maleylacetoacet ( 220) 236 65.9 3.4e-08 gluthathione S-transferase mu [Takifugu obscurus] ( 220) 236 65.9 3.4e-08 putative glutathione S-transferase [Polysphondyliu ( 197) 235 65.8 3.5e-08 ref|XP_008528309.1| PREDICTED: glutathione S-t ( 225) 236 65.9 3.5e-08 ref|XP_004318365.1| PREDICTED: hematopoietic p ( 199) 235 65.7 3.6e-08 ref|XP_004470429.1| PREDICTED: hematopoietic p ( 199) 235 65.7 3.6e-08 ref|XP_005044873.1| PREDICTED: hematopoietic p ( 199) 235 65.7 3.6e-08 Glutathione S-transferase [Cerapachys biroi] ( 202) 235 65.7 3.6e-08 Glutathione S-transferase [Echinococcus granulosus ( 566) 243 67.2 3.6e-08 sp|P46429.1|GST2_MANSE RecName: Full=Glutathione ( 203) 235 65.7 3.6e-08 Glutathione S-transferase [Cerapachys biroi] ( 203) 235 65.7 3.6e-08 ref|XP_004998907.1| hypothetical protein PTSG_ ( 206) 235 65.7 3.7e-08 ref|NP_497116.1| Protein GST-27 [Caenorhabditis ( 209) 235 65.7 3.8e-08 hypothetical protein HMPREF1544_00794 [Mucor circi ( 213) 235 65.7 3.9e-08 putative glutathione S-transferase [Pyropia yezoen ( 217) 235 65.7 4e-08 ref|XP_001495376.1| PREDICTED: glutathione S-t ( 218) 235 65.7 4e-08 ref|XP_005677997.1| PREDICTED: glutathione S-t ( 218) 235 65.7 4e-08 ref|XP_006899384.1| PREDICTED: glutathione S-t ( 218) 235 65.7 4e-08 ref|XP_005338161.1| PREDICTED: glutathione S-t ( 218) 235 65.7 4e-08 glutathione s-transferase [Stylonychia lemnae] ( 221) 235 65.7 4.1e-08 glutathione s-n-terminal domain containing protein ( 222) 235 65.7 4.1e-08 ref|XP_003108863.1| hypothetical protein CRE_1 ( 222) 235 65.7 4.1e-08 ref|XP_009032343.1| hypothetical protein AURAN ( 196) 234 65.5 4.1e-08 ref|XP_005670305.1| PREDICTED: glutathione S-t ( 256) 236 65.9 4.2e-08 Hematopoietic prostaglandin D synthase [Mesitornis ( 199) 234 65.5 4.2e-08 ref|XP_009009940.1| hypothetical protein HELRO ( 201) 234 65.5 4.3e-08 ref|WP_020027195.1| hypothetical protein [gamm ( 230) 235 65.7 4.3e-08 ref|XP_967475.1| PREDICTED: glutathione S-trans ( 204) 234 65.5 4.4e-08 ref|XP_001015696.1| Glutathione S-transferase, ( 234) 235 65.7 4.4e-08 ref|NP_496859.1| Protein GST-24 [Caenorhabditis ( 209) 234 65.5 4.5e-08 ref|NP_001004964.1| glutathione S-transferase m ( 216) 234 65.5 4.7e-08 ref|XP_004026326.1| PREDICTED: glutathione S-t ( 218) 234 65.5 4.8e-08 GSTM2, partial [synthetic construct] ( 218) 234 65.5 4.8e-08 ref|XP_005677998.1| PREDICTED: glutathione S-t ( 218) 234 65.5 4.8e-08 ref|XP_005367914.1| PREDICTED: glutathione S-t ( 218) 234 65.5 4.8e-08 ref|XP_005891359.1| PREDICTED: glutathione S-t ( 218) 234 65.5 4.8e-08 ref|NP_034488.1| glutathione S-transferase Mu 1 ( 218) 234 65.5 4.8e-08 ref|XP_002715842.1| PREDICTED: glutathione S-t ( 218) 234 65.5 4.8e-08 ref|XP_005388943.1| PREDICTED: glutathione S-t ( 218) 234 65.5 4.8e-08 ref|XP_006180023.1| PREDICTED: glutathione S-t ( 218) 234 65.5 4.8e-08 glutathione S-transferase mu 4 [Meleagris gallopav ( 220) 234 65.5 4.8e-08 ref|XP_004898467.1| PREDICTED: glutathione S-t ( 220) 234 65.5 4.8e-08 ref|XP_005388953.1| PREDICTED: glutathione S-t ( 225) 234 65.4 5e-08 mCG131602, isoform CRA_c [Mus musculus] ( 225) 234 65.4 5e-08 glutathionetransferase [Riptortus pedestris] ( 198) 233 65.3 5e-08 ref|XP_005360687.1| PREDICTED: hematopoietic p ( 199) 233 65.3 5e-08 ref|XP_009271813.1| PREDICTED: hematopoietic p ( 199) 233 65.3 5e-08 ref|XP_002610573.1| hypothetical protein BRAFL ( 200) 233 65.3 5e-08 glutathione S-transferase S3 [Laodelphax striatell ( 202) 233 65.3 5.1e-08 ref|XP_005985364.1| PREDICTED: glutathione S-t ( 237) 234 65.4 5.3e-08 glutathione S-transferase sigma-class [Solen grand ( 214) 233 65.2 5.5e-08 ref|XP_005388946.1| PREDICTED: glutathione S-t ( 218) 233 65.2 5.6e-08 ref|XP_005076679.1| PREDICTED: glutathione S-t ( 218) 233 65.2 5.6e-08 glutathione S-transferase M1 [Homo sapiens] ( 218) 233 65.2 5.6e-08 ref|XP_005388948.1| PREDICTED: glutathione S-t ( 218) 233 65.2 5.6e-08 ref|XP_005338158.1| PREDICTED: glutathione S-t ( 218) 233 65.2 5.6e-08 glutathione S-transferase mu [synthetic construct] ( 218) 233 65.2 5.6e-08 ref|XP_004002341.1| PREDICTED: glutathione S-t ( 218) 233 65.2 5.6e-08 Glutathione S-transferase Mu 3 [Esox lucius] ( 219) 233 65.2 5.7e-08 ref|XP_005850277.1| hypothetical protein CHLNC ( 220) 233 65.2 5.7e-08 ref|XP_008411531.1| PREDICTED: glutathione S-t ( 220) 233 65.2 5.7e-08 ref|XP_004431021.1| PREDICTED: hematopoietic p ( 199) 232 65.0 5.9e-08 ref|XP_005877842.1| PREDICTED: hematopoietic p ( 199) 232 65.0 5.9e-08 hypothetical protein PPL_09115 [Polysphondylium pa ( 199) 232 65.0 5.9e-08 ref|XP_004366649.1| hypothetical protein DFA_0 ( 199) 232 65.0 5.9e-08 ref|XP_005076121.1| PREDICTED: hematopoietic p ( 199) 232 65.0 5.9e-08 ref|XP_004390496.1| PREDICTED: glutathione S-t ( 227) 233 65.2 5.9e-08 ref|XP_792497.3| PREDICTED: glutathione S-tran ( 121) 228 64.3 6e-08 sp|P46428.4|GST_ANOGA RecName: Full=Glutathion ( 203) 232 65.0 6.1e-08 ref|XP_008549295.1| PREDICTED: glutathione S-t ( 203) 232 65.0 6.1e-08 glutathione S-transferase sigma [Chilo suppressali ( 204) 232 65.0 6.1e-08 sigma glutathione S-transferase [Locusta migratori ( 204) 232 65.0 6.1e-08 glutathione S-transferase sigma 5 [Spodoptera litu ( 205) 232 65.0 6.1e-08 glutathione S-transferase [Gryllotalpa orientalis] ( 207) 232 65.0 6.2e-08 ref|XP_004994854.1| hypothetical protein PTSG_ ( 349) 236 65.7 6.3e-08 glutathione S-transferase, partial [Schistosoma ma ( 211) 232 65.0 6.4e-08 ref|XP_006572108.1| PREDICTED: glutathione S-t ( 164) 230 64.6 6.4e-08 Hematopoietic prostaglandin D synthase [Myotis bra ( 213) 232 65.0 6.5e-08 ref|XP_003933466.1| PREDICTED: glutathione S-t ( 217) 232 65.0 6.6e-08 ref|XP_004689739.1| PREDICTED: glutathione S-t ( 218) 232 65.0 6.7e-08 ref|XP_005197839.1| PREDICTED: glutathione S-t ( 218) 232 65.0 6.7e-08 ref|NP_741060.2| Protein GST-34 [Caenorhabditis ( 218) 232 65.0 6.7e-08 ref|XP_311546.4| AGAP010404-PA [Anopheles gamb ( 218) 232 65.0 6.7e-08 ref|NP_081040.1| glutathione S-transferase mu 4 ( 218) 232 65.0 6.7e-08 ref|XP_005388949.1| PREDICTED: glutathione S-t ( 218) 232 65.0 6.7e-08 ref|XP_008848599.1| PREDICTED: glutathione S-t ( 218) 232 65.0 6.7e-08 ref|XP_004002342.1| PREDICTED: glutathione S-t ( 218) 232 65.0 6.7e-08 ref|NP_062328.3| hematopoietic prostaglandin D ( 199) 231 64.8 7e-08 GSTM2 protein [Bos taurus] ( 229) 232 64.9 7.1e-08 ref|XP_002605353.1| hypothetical protein BRAFL ( 202) 231 64.8 7.1e-08 glutathione s-transferase S1 [Nilaparvata lugens] ( 202) 231 64.8 7.1e-08 ref|XP_003703001.1| PREDICTED: glutathione S-t ( 265) 233 65.1 7.3e-08 glutathione S-transferase [Cyclina sinensis] ( 206) 231 64.8 7.3e-08 ref|XP_003116026.1| hypothetical protein CRE_0 ( 141) 228 64.2 7.4e-08 mCG144942, isoform CRA_a [Mus musculus] ( 236) 232 64.9 7.4e-08 glutathione S-transferase sigma 2 [Danaus plexippu ( 269) 233 65.1 7.4e-08 putative: similar to glutathione S-transferase, pi ( 213) 231 64.7 7.7e-08 glutathione s-pi 1 [Stylonychia lemnae] ( 213) 231 64.7 7.7e-08 ref|XP_006899379.1| PREDICTED: glutathione S-t ( 218) 231 64.7 7.9e-08 ref|XP_002715845.1| PREDICTED: glutathione S-t ( 218) 231 64.7 7.9e-08 ref|XP_004620127.1| PREDICTED: glutathione S-t ( 218) 231 64.7 7.9e-08 ref|XP_006219731.1| PREDICTED: glutathione S-t ( 218) 231 64.7 7.9e-08 ref|XP_008528317.1| PREDICTED: glutathione S-t ( 218) 231 64.7 7.9e-08 ref|XP_008848598.1| PREDICTED: glutathione S-t ( 219) 231 64.7 7.9e-08 ref|XP_002774487.1| glutathione s-transferase, ( 711) 240 66.4 8.2e-08 ref|NP_001186973.1| hematopoietic prostaglandi ( 199) 230 64.5 8.3e-08 ref|XP_003386766.1| PREDICTED: glutathione S-t ( 201) 230 64.5 8.4e-08 glutathione S-transferase sigma 2 [Cnaphalocrocis ( 202) 230 64.5 8.5e-08 glutathione S-transferase sigma class protein [Cra ( 203) 230 64.5 8.5e-08 hypothetical protein PPL_01815 [Polysphondylium pa ( 660) 239 66.2 8.8e-08 NADH dehydrogenase [ubiquinone] flavoprotein 1 [Ch ( 583) 238 66.0 8.8e-08 hypothetical protein Y032_0016g3100 [Ancylostoma c ( 210) 230 64.5 8.9e-08 allergen Aca s 8 [Acarus siro] ( 212) 230 64.5 9e-08 ref|XP_008294198.1| PREDICTED: glutathione S-t ( 215) 230 64.5 9.2e-08 unnamed protein product [Oncorhynchus mykiss] ( 216) 230 64.5 9.2e-08 ref|XP_005338160.1| PREDICTED: glutathione S-t ( 218) 230 64.5 9.4e-08 ref|XP_005388945.1| PREDICTED: glutathione S-t ( 218) 230 64.5 9.4e-08 ref|XP_004689742.1| PREDICTED: glutathione S-t ( 218) 230 64.5 9.4e-08 ref|XP_005985354.1| PREDICTED: glutathione S-t ( 218) 230 64.5 9.4e-08 ref|XP_004898471.1| PREDICTED: glutathione S-t ( 218) 230 64.5 9.4e-08 ref|XP_006979548.1| PREDICTED: glutathione S-t ( 218) 230 64.5 9.4e-08 ref|XP_004659084.1| PREDICTED: glutathione S-t ( 218) 230 64.5 9.4e-08 ref|XP_006092640.1| PREDICTED: glutathione S-t ( 218) 230 64.5 9.4e-08 ref|XP_004341082.1| glutathione Stransferase, ( 192) 229 64.3 9.4e-08 ref|XP_005111498.1| PREDICTED: glutathione S-t ( 169) 228 64.1 9.4e-08 ref|XP_005700085.1| PREDICTED: glutathione S-t ( 224) 230 64.5 9.7e-08 unnamed protein product [Mus musculus] ( 199) 229 64.3 9.8e-08 ref|XP_001497346.1| PREDICTED: hematopoietic p ( 199) 229 64.3 9.8e-08 ref|XP_006762367.1| PREDICTED: hematopoietic p ( 199) 229 64.3 9.8e-08 ref|XP_007954911.1| PREDICTED: hematopoietic p ( 199) 229 64.3 9.8e-08 Glutathione S-transferase [Acromyrmex echinatior] (1068) 242 66.7 1e-07 glutathione s-transferase S1 [Sogatella furcifera] ( 202) 229 64.3 1e-07 glutathione S-transferase [Helicoverpa armigera] ( 206) 229 64.3 1e-07 hypothetical protein Y032_0016g3100 [Ancylostoma c ( 235) 230 64.4 1e-07 ref|WP_015452108.1| glutathione S transferase ( 207) 229 64.3 1e-07 ref|WP_004304680.1| glutathione S-transferase- ( 207) 229 64.3 1e-07 ref|XP_006762366.1| PREDICTED: hematopoietic p ( 217) 229 64.2 1.1e-07 ref|XP_003444865.1| PREDICTED: glutathione S-t ( 217) 229 64.2 1.1e-07 ref|XP_004659083.1| PREDICTED: glutathione S-t ( 217) 229 64.2 1.1e-07 ref|XP_004420773.1| PREDICTED: glutathione S-t ( 218) 229 64.2 1.1e-07 ref|XP_006866011.1| PREDICTED: glutathione S-t ( 218) 229 64.2 1.1e-07 ref|XP_004420769.1| PREDICTED: glutathione S-t ( 218) 229 64.2 1.1e-07 ref|XP_004026327.1| PREDICTED: glutathione S-t ( 218) 229 64.2 1.1e-07 ref|XP_005985356.1| PREDICTED: glutathione S-t ( 218) 229 64.2 1.1e-07 Der f 8 allergen [Dermatophagoides farinae] ( 219) 229 64.2 1.1e-07 ref|XP_005239670.1| PREDICTED: glutathione S-t ( 220) 229 64.2 1.1e-07 GST-like hemolymph protein [Corcyra cephalonica] ( 195) 228 64.0 1.1e-07 ref|XP_003267973.1| PREDICTED: glutathione S-t ( 222) 229 64.2 1.1e-07 glutathione S-transferase mu5 [Tigriopus japonicus ( 222) 229 64.2 1.1e-07 ref|XP_005860172.1| PREDICTED: glutathione S-t ( 222) 229 64.2 1.1e-07 ref|XP_005102227.1| PREDICTED: probable glutat ( 173) 227 63.9 1.1e-07 ref|XP_007100306.1| PREDICTED: hematopoietic p ( 199) 228 64.0 1.2e-07 ref|XP_009068778.1| PREDICTED: hematopoietic p ( 199) 228 64.0 1.2e-07 putative glutathione S-transferase [Phytophthora s ( 200) 228 64.0 1.2e-07 CBN-GST-33 protein [Caenorhabditis brenneri] ( 201) 228 64.0 1.2e-07 ref|XP_002434827.1| glutathione S-transferase, ( 230) 229 64.2 1.2e-07 sigma class glutathione-s-transferase 3 [Haliotis ( 203) 228 64.0 1.2e-07 ref|XP_008207870.1| PREDICTED: glutathione S-t ( 204) 228 64.0 1.2e-07 ref|XP_004417392.1| PREDICTED: glutathione S-t ( 233) 229 64.2 1.2e-07 glutathione S transferase S1 [Papilio xuthus] ( 206) 228 64.0 1.2e-07 ref|XP_005059567.1| PREDICTED: glutathione S-t ( 306) 231 64.6 1.2e-07 glutathione S-transferase Ya subunit, partial [Rat ( 31) 213 61.2 1.3e-07 ref|XP_002631506.1| C. briggsae CBR-GST-24 pro ( 216) 228 64.0 1.3e-07 ref|NP_803175.1| glutathione S-transferase Mu 2 ( 218) 228 64.0 1.3e-07 ref|XP_004449003.1| PREDICTED: glutathione S-t ( 218) 228 64.0 1.3e-07 ref|XP_005367925.1| PREDICTED: glutathione S-t ( 218) 228 64.0 1.3e-07 glutathione S-transferase [Homo sapiens] ( 218) 228 64.0 1.3e-07 ref|XP_005090419.1| PREDICTED: hematopoietic p ( 149) 225 63.4 1.3e-07 ref|NP_001156323.1| glutathione S-transferase ( 219) 228 64.0 1.3e-07 glutathione S-transferase S1-2 [Anopheles gambiae] ( 195) 227 63.8 1.3e-07 Hematopoietic prostaglandin D synthase [Picoides p ( 199) 227 63.8 1.4e-07 ref|XP_006084688.1| PREDICTED: hematopoietic p ( 199) 227 63.8 1.4e-07 ref|XP_004277027.1| PREDICTED: hematopoietic p ( 199) 227 63.8 1.4e-07 unnamed protein product [Oncorhynchus mykiss] ( 199) 227 63.8 1.4e-07 ref|XP_007169516.1| PREDICTED: glutathione S-t ( 227) 228 64.0 1.4e-07 similar to Glutathione S-transferase A1 (GTH1) (HA ( 63) 218 62.1 1.4e-07 glutathione S-transferase sigma 5 [Locusta migrato ( 202) 227 63.8 1.4e-07 AAEL011741-PA [Aedes aegypti] ( 203) 227 63.8 1.4e-07 glutathione S-transferase sigma [Tenebrio molitor] ( 205) 227 63.8 1.4e-07 ref|WP_012584252.1| glutathione S-transferase ( 207) 227 63.8 1.5e-07 ref|XP_002767548.1| Glutathione S-transferase, ( 211) 227 63.8 1.5e-07 ref|XP_008334086.1| PREDICTED: maleylacetoacet ( 212) 227 63.8 1.5e-07 ref|XP_004517382.1| PREDICTED: glutathione S-t ( 243) 228 63.9 1.5e-07 ref|NP_501847.1| Protein GST-2 [Caenorhabditis ( 188) 226 63.6 1.5e-07 ref|XP_008334005.1| PREDICTED: maleylacetoacet ( 216) 227 63.8 1.5e-07 ref|NP_001268559.1| glutathione S-transferase ( 218) 227 63.7 1.6e-07 ref|XP_006742870.1| PREDICTED: glutathione S-t ( 218) 227 63.7 1.6e-07 ref|XP_006149601.1| PREDICTED: glutathione S-t ( 218) 227 63.7 1.6e-07 ref|XP_001430001.1| hypothetical protein [Para ( 218) 227 63.7 1.6e-07 ref|XP_006979553.1| PREDICTED: glutathione S-t ( 218) 227 63.7 1.6e-07 ref|XP_008848597.1| PREDICTED: glutathione S-t ( 218) 227 63.7 1.6e-07 ref|XP_002919257.1| PREDICTED: glutathione S-t ( 218) 227 63.7 1.6e-07 ref|XP_005678001.1| PREDICTED: glutathione S-t ( 218) 227 63.7 1.6e-07 ref|XP_001495425.1| PREDICTED: glutathione S-t ( 218) 227 63.7 1.6e-07 ref|XP_005801386.1| PREDICTED: glutathione S-t ( 220) 227 63.7 1.6e-07 ref|XP_004365010.1| maleylacetoacetate isomera ( 222) 227 63.7 1.6e-07 ref|XP_004703325.1| PREDICTED: hematopoietic p ( 199) 226 63.5 1.6e-07 ref|XP_006164556.1| PREDICTED: hematopoietic p ( 199) 226 63.5 1.6e-07 hypothetical protein PPL_07385 [Polysphondylium pa ( 200) 226 63.5 1.6e-07 ref|WP_020027955.1| hypothetical protein [gamm ( 230) 227 63.7 1.7e-07 ref|XP_001661871.1| glutathione s-transferase ( 203) 226 63.5 1.7e-07 pdb|4ECC|A Chain A, Chimeric Gst Containing In ( 231) 227 63.7 1.7e-07 putative glutathione S-transferase [Polysphondyliu ( 233) 227 63.7 1.7e-07 ref|XP_002633763.1| C. briggsae CBR-GST-4 prot ( 207) 226 63.5 1.7e-07 Protein GST-25 [Caenorhabditis elegans] ( 208) 226 63.5 1.7e-07 ref|XP_005007912.1| PREDICTED: glutathione S-t ( 184) 225 63.3 1.7e-07 pdb|2WB9|A Chain A, Fasciola Hepatica Sigma Cl ( 211) 226 63.5 1.8e-07 putative: similar to glutathione S-transferase, pi ( 213) 226 63.5 1.8e-07 glutathione S-transferase M1 [Xenopus (Silurana) t ( 216) 226 63.5 1.8e-07 ref|XP_005985357.1| PREDICTED: glutathione S-t ( 217) 226 63.5 1.8e-07 ref|XP_003978826.1| PREDICTED: glutathione S-t ( 220) 226 63.5 1.9e-07 ref|XP_009066760.1| hypothetical protein LOTGI ( 197) 225 63.3 1.9e-07 ref|XP_005981247.1| PREDICTED: hematopoietic p ( 199) 225 63.3 1.9e-07 ref|XP_001415525.1| predicted protein, partial ( 200) 225 63.3 1.9e-07 ref|NP_001134543.1| Glutathione-requiring pros ( 201) 225 63.3 2e-07 ref|XP_003386763.1| PREDICTED: glutathione S-t ( 201) 225 63.3 2e-07 glutathione S-transferase [Anopheles sinensis] ( 203) 225 63.3 2e-07 sigma glutathione S-transferase [Ruditapes philipp ( 203) 225 63.3 2e-07 glutathione S transferase S1 [Papilio polytes] ( 204) 225 63.3 2e-07 Glutathione S-transferase Mu 3, partial [Corvus br ( 206) 225 63.3 2e-07 ref|XP_001661870.1| glutathione s-transferase ( 237) 226 63.5 2.1e-07 glutathione S transferase S1 [Papilio xuthus] ( 185) 224 63.1 2.1e-07 sp|P16413.1|GSTMU_CAVPO RecName: Full=Glutathione ( 217) 225 63.3 2.2e-07 Glutathione S-transferase Mu 1 [Fukomys damarensis ( 218) 225 63.3 2.2e-07 ref|XP_004002344.1| PREDICTED: glutathione S-t ( 218) 225 63.3 2.2e-07 ref|XP_003515816.1| PREDICTED: glutathione S-t ( 218) 225 63.3 2.2e-07 glutathione S-transferase M1 protein [synthetic co ( 218) 225 63.3 2.2e-07 ref|XP_005367929.1| PREDICTED: glutathione S-t ( 218) 225 63.3 2.2e-07 ref|XP_537038.2| PREDICTED: glutathione S-trans ( 218) 225 63.3 2.2e-07 ref|XP_008564857.1| PREDICTED: glutathione S-t ( 218) 225 63.3 2.2e-07 ref|XP_002751232.1| PREDICTED: glutathione S-t ( 218) 225 63.3 2.2e-07 ref|XP_008702247.1| PREDICTED: glutathione S-t ( 218) 225 63.3 2.2e-07 ref|XP_005076672.1| PREDICTED: glutathione S-t ( 218) 225 63.3 2.2e-07 ref|XP_005338155.1| PREDICTED: glutathione S-t ( 218) 225 63.3 2.2e-07 ref|XP_003978825.1| PREDICTED: glutathione S-t ( 220) 225 63.3 2.2e-07 ref|XP_008961224.1| PREDICTED: glutathione S-t ( 222) 225 63.3 2.2e-07 ref|XP_008482931.1| PREDICTED: glutathione S-t ( 288) 227 63.6 2.2e-07 ref|XP_006900807.1| PREDICTED: hematopoietic p ( 199) 224 63.1 2.3e-07 glutathione S-transferase s1 protein [Spodoptera l ( 201) 224 63.1 2.3e-07 hypothetical protein F441_16349 [Phytophthora para ( 260) 226 63.4 2.3e-07 ref|WP_005495108.1| glutathione S-transferase- ( 202) 224 63.0 2.3e-07 ref|XP_002681096.1| predicted protein [Naegler ( 203) 224 63.0 2.4e-07 Glutathione S-transferase Mu 5 [Myotis brandtii] ( 569) 232 64.5 2.4e-07 glutathione S-transferase [Eisenia fetida] ( 206) 224 63.0 2.4e-07 glutathione S-transferase [Blepharisma japonicum] ( 208) 224 63.0 2.4e-07 glutathione transferase (EC 2.5.1.18), partial [Mu ( 209) 224 63.0 2.4e-07 ref|XP_007169515.1| PREDICTED: glutathione S-t ( 185) 223 62.8 2.5e-07 Hematopoietic prostaglandin D synthase, partial [S ( 214) 224 63.0 2.5e-07 glutathione S-transferase mu 2 [Sus scrofa] ( 189) 223 62.8 2.5e-07 ref|XP_003756257.1| PREDICTED: maleylacetoacet ( 217) 224 63.0 2.6e-07 ref|WP_018038209.1| hypothetical protein [alph ( 217) 224 63.0 2.6e-07 pdb|1GTU|A Chain A, Ligand-Free Human Glutathion ( 217) 224 63.0 2.6e-07 pdb|4GTU|A Chain A, Ligand-Free Homodimeric Huma ( 217) 224 63.0 2.6e-07 ref|NP_112416.1| glutathione S-transferase Yb-3 ( 218) 224 63.0 2.6e-07 ref|XP_513625.2| PREDICTED: glutathione S-tran ( 218) 224 63.0 2.6e-07 ref|XP_005891356.1| PREDICTED: glutathione S-t ( 218) 224 63.0 2.6e-07 ref|NP_032209.1| glutathione S-transferase Mu 2 ( 218) 224 63.0 2.6e-07 ref|NP_000552.2| glutathione S-transferase Mu 1 ( 218) 224 63.0 2.6e-07 ref|XP_004689737.1| PREDICTED: glutathione S-t ( 218) 224 63.0 2.6e-07 ref|NP_000841.1| glutathione S-transferase Mu 4 ( 218) 224 63.0 2.6e-07 glutathione-S-transferase M1 [Homo sapiens] ( 218) 224 63.0 2.6e-07 ref|XP_003892388.1| PREDICTED: glutathione S-t ( 218) 224 63.0 2.6e-07 ref|XP_007975859.1| PREDICTED: glutathione S-t ( 218) 224 63.0 2.6e-07 ref|XP_005367931.1| PREDICTED: glutathione S-t ( 218) 224 63.0 2.6e-07 glutathione S-transferase M4 [synthetic construct] ( 219) 224 63.0 2.6e-07 mCG4061 [Mus musculus] ( 219) 224 63.0 2.6e-07 glutathione S-transferase mu4 [Panonychus citri] ( 225) 224 63.0 2.7e-07 glutathione S-transferase [Chironomus tentans] ( 201) 223 62.8 2.8e-07 Glutathione S-transferase A2 [Heterocephalus glabe ( 82) 216 61.5 2.8e-07 Glutathione S-transferase [Echinococcus granulosus ( 438) 229 63.9 2.8e-07 ref|XP_007653159.1| PREDICTED: glutathione S-t ( 184) 222 62.6 2.9e-07 ref|XP_002143473.1| glutathione S-transferase, ( 238) 224 63.0 2.9e-07 ref|XP_008848594.1| PREDICTED: glutathione S-t ( 188) 222 62.6 3e-07 ref|XP_004517385.1| PREDICTED: glutathione S-t ( 244) 224 63.0 3e-07 ref|XP_004898469.1| PREDICTED: glutathione S-t ( 189) 222 62.6 3e-07 ref|XP_004554295.1| PREDICTED: glutathione S-t ( 215) 223 62.8 3e-07 ref|XP_007549385.1| PREDICTED: maleylacetoacet ( 216) 223 62.8 3e-07 ref|XP_006785619.1| PREDICTED: glutathione S-t ( 217) 223 62.8 3e-07 pdb|6GSW|A Chain A, First-Sphere And Second-Sphe ( 217) 223 62.8 3e-07 ref|XP_004659080.1| PREDICTED: glutathione S-t ( 218) 223 62.8 3.1e-07 ref|XP_003267968.1| PREDICTED: glutathione S-t ( 218) 223 62.8 3.1e-07 glutathione S-transferase, partial [Anopheles gamb ( 218) 223 62.8 3.1e-07 ref|XP_006979551.1| PREDICTED: glutathione S-t ( 218) 223 62.8 3.1e-07 ref|XP_005891362.1| PREDICTED: glutathione S-t ( 218) 223 62.8 3.1e-07 ref|XP_003933465.1| PREDICTED: glutathione S-t ( 218) 223 62.8 3.1e-07 ref|XP_003220233.1| PREDICTED: glutathione S-t ( 220) 223 62.8 3.1e-07 ref|XP_007549384.1| PREDICTED: maleylacetoacet ( 220) 223 62.8 3.1e-07 glutathione s-transferase [Xenopus laevis] ( 194) 222 62.6 3.1e-07 Glutathione S-transferase 2 [Ophiophagus hannah] ( 221) 223 62.8 3.1e-07 ref|NP_001079730.1| prostaglandin D2 synthase, ( 197) 222 62.6 3.2e-07 ref|XP_008141767.1| PREDICTED: hematopoietic p ( 199) 222 62.6 3.2e-07 ref|XP_005762007.1| hypothetical protein EMIHU ( 227) 223 62.8 3.2e-07 Glutathione S-transferase P 1 [Rana catesbeiana] ( 155) 220 62.2 3.3e-07 ref|XP_007782747.1| hypothetical protein W97_0 ( 229) 223 62.7 3.3e-07 ref|XP_006966946.1| predicted protein [Trichod ( 203) 222 62.6 3.3e-07 ref|XP_005096729.1| PREDICTED: glutathione S-t ( 204) 222 62.6 3.3e-07 24 kDa female-specific fat body protein [Actias se ( 207) 222 62.5 3.4e-07 ref|XP_004044254.1| PREDICTED: glutathione S-t ( 58) 212 60.7 3.4e-07 ref|XP_008636253.1| PREDICTED: glutathione S-t ( 316) 225 63.1 3.6e-07 ref|XP_007619931.1| PREDICTED: glutathione S-t ( 216) 222 62.5 3.6e-07 ref|XP_005076681.1| PREDICTED: glutathione S-t ( 218) 222 62.5 3.6e-07 ref|XP_005367916.1| PREDICTED: glutathione S-t ( 218) 222 62.5 3.6e-07 ref|XP_007529406.1| PREDICTED: glutathione S-t ( 218) 222 62.5 3.6e-07 ref|XP_005367911.1| PREDICTED: glutathione S-t ( 218) 222 62.5 3.6e-07 ref|NP_001077241.1| glutathione S-transferase ( 218) 222 62.5 3.6e-07 ref|XP_002919256.1| PREDICTED: glutathione S-t ( 218) 222 62.5 3.6e-07 ref|XP_004637043.1| PREDICTED: glutathione S-t ( 193) 221 62.3 3.7e-07 Glutathione S-transferase Mu 2 [Tupaia chinensis] ( 417) 227 63.4 3.7e-07 glutathione S-transferase zeta 1 isoform 2 [Oplegn ( 220) 222 62.5 3.7e-07 ref|XP_006506461.1| PREDICTED: hematopoietic p ( 200) 221 62.3 3.8e-07 hypothetical protein TRIATDRAFT_91074 [Trichoderma ( 202) 221 62.3 3.9e-07 glutathione S-transferase [Chironomus tentans] ( 204) 221 62.3 3.9e-07 Glutathione S-transferase P [Strongyloides ratti] ( 206) 221 62.3 4e-07 ref|NP_496858.1| Protein GST-20 [Caenorhabditis ( 207) 221 62.3 4e-07 ref|XP_002633764.1| Hypothetical protein CBG03 ( 207) 221 62.3 4e-07 ref|NP_501848.1| Protein GST-4 [Caenorhabditis ( 207) 221 62.3 4e-07 hypothetical protein Y032_0110g154 [Ancylostoma ce ( 161) 219 61.9 4e-07 hypothetical protein Y032_0110g151 [Ancylostoma ce ( 161) 219 61.9 4e-07 hypothetical protein CAPTEDRAFT_193166 [Capitella ( 211) 221 62.3 4.1e-07 glutathione transferase [Chlamys islandica] ( 214) 221 62.3 4.2e-07 S-crystallin SL11 [Crassostrea gigas] ( 189) 220 62.1 4.2e-07 ref|XP_008398449.1| PREDICTED: maleylacetoacet ( 216) 221 62.3 4.3e-07 glutathione S-transferase (EC 2.5.1.18) [Rattus no ( 216) 221 62.3 4.3e-07 pdb|1GSB|A Chain A, New Crystal Forms Of A Mu Cla ( 217) 221 62.3 4.3e-07 ref|XP_005367923.1| PREDICTED: glutathione S-t ( 217) 221 62.3 4.3e-07 pdb|1MTC|A Chain A, Glutathione Transferase Mut ( 217) 221 62.3 4.3e-07 pdb|6GSU|A Chain A, First-Sphere And Second-Sphe ( 217) 221 62.3 4.3e-07 glutathione transferase M4 [Homo sapiens] ( 218) 221 62.3 4.3e-07 ref|XP_004769771.1| PREDICTED: glutathione S-t ( 218) 221 62.3 4.3e-07 ref|NP_058710.1| glutathione S-transferase Mu 1 ( 218) 221 62.3 4.3e-07 ref|XP_004620119.1| PREDICTED: glutathione S-t ( 218) 221 62.3 4.3e-07 ref|XP_005542508.1| PREDICTED: glutathione S-t ( 218) 221 62.3 4.3e-07 ref|XP_004659079.1| PREDICTED: glutathione S-t ( 218) 221 62.3 4.3e-07 glutathione S-transferase M1 [synthetic construct] ( 218) 221 62.3 4.3e-07 ref|XP_004816313.1| PREDICTED: glutathione S-t ( 218) 221 62.3 4.3e-07 ref|XP_002919258.1| PREDICTED: glutathione S-t ( 218) 221 62.3 4.3e-07 ref|XP_005367921.1| PREDICTED: glutathione S-t ( 218) 221 62.3 4.3e-07 rCG29047, isoform CRA_b [Rattus norvegicus] ( 218) 221 62.3 4.3e-07 ref|XP_006197483.1| PREDICTED: glutathione S-t ( 218) 221 62.3 4.3e-07 glutathione S-transferase M1 [synthetic construct] ( 219) 221 62.3 4.3e-07 ref|XP_008398448.1| PREDICTED: maleylacetoacet ( 220) 221 62.3 4.4e-07 glutathione s-transferase [Stylonychia lemnae] ( 328) 224 62.8 4.4e-07 pdb|4ECB|A Chain A, Chimeric Gst Containing In ( 228) 221 62.3 4.6e-07 ref|XP_003386764.1| PREDICTED: glutathione S-t ( 201) 220 62.1 4.6e-07 unnamed protein product [Mus musculus] ( 49) 209 60.0 4.6e-07 Glutathione S-transferase P 2 [Pteropus alecto] ( 208) 220 62.1 4.8e-07 ref|NP_001273827.1| glutathione S-transferase ( 241) 221 62.2 4.9e-07 hypothetical protein CAPTEDRAFT_165896 [Capitella ( 165) 218 61.7 5e-07 Hematopoietic prostaglandin D synthase [Chelonia m ( 114) 215 61.1 5.1e-07 pdb|6GSV|A Chain A, First-Sphere And Second-Sphe ( 217) 220 62.0 5.1e-07 ref|XP_002810527.1| PREDICTED: glutathione S-t ( 218) 220 62.0 5.1e-07 ref|XP_004388077.1| PREDICTED: glutathione S-t ( 218) 220 62.0 5.1e-07 ref|XP_004420768.1| PREDICTED: glutathione S-t ( 218) 220 62.0 5.1e-07 ref|XP_001165087.2| PREDICTED: glutathione S-t ( 218) 220 62.0 5.1e-07 sp|Q00285.2|GSTMU_CRILO RecName: Full=Glutathione ( 218) 220 62.0 5.1e-07 ref|XP_003267962.1| PREDICTED: glutathione S-t ( 218) 220 62.0 5.1e-07 ref|XP_006979555.1| PREDICTED: glutathione S-t ( 218) 220 62.0 5.1e-07 glutathione S-transferase mu 4 [Meleagris gallopav ( 220) 220 62.0 5.2e-07 ref|XP_003409441.1| PREDICTED: glutathione S-t ( 380) 224 62.8 5.4e-07 Probable maleylacetoacetate isomerase 2 [Caligus c ( 229) 220 62.0 5.4e-07 ref|XP_002434207.1| glutathione S-transferase, ( 229) 220 62.0 5.4e-07 ref|XP_002715840.2| PREDICTED: glutathione S-t ( 265) 221 62.2 5.6e-07 ref|NP_496864.1| Protein GST-19 [Caenorhabditis ( 207) 219 61.8 5.6e-07 ref|XP_001847604.1| glutathione s-transferase ( 238) 220 62.0 5.7e-07 ref|XP_001697204.1| hypothetical protein CHLRE ( 273) 221 62.2 5.8e-07 glutathione s-transferase [Stylonychia lemnae] ( 212) 219 61.8 5.8e-07 hypothetical protein OXYTRI_12075 [Oxytricha trifa ( 215) 219 61.8 5.9e-07 ref|XP_005426900.1| PREDICTED: glutathione S-t ( 245) 220 62.0 6e-07 ref|XP_003453103.1| PREDICTED: maleylacetoacet ( 216) 219 61.8 6e-07 ref|XP_008959226.1| PREDICTED: maleylacetoacet ( 217) 219 61.8 6e-07 glutathione S-transferase, amine-terminal domain p ( 217) 219 61.8 6e-07 pdb|5FWG|A Chain A, Tetra-(5-Fluorotryptophanyl) ( 217) 219 61.8 6e-07 ref|XP_004626827.1| PREDICTED: glutathione S-t ( 191) 218 61.6 6e-07 ref|XP_003810690.1| PREDICTED: glutathione S-t ( 218) 219 61.8 6e-07 ref|XP_004582013.1| PREDICTED: glutathione S-t ( 218) 219 61.8 6e-07 ref|XP_004582012.1| PREDICTED: glutathione S-t ( 218) 219 61.8 6e-07 hypothetical protein PANDA_007883 [Ailuropoda mela ( 169) 217 61.4 6.1e-07 ref|XP_003453104.1| PREDICTED: maleylacetoacet ( 220) 219 61.8 6.1e-07 ref|XP_007053551.1| PREDICTED: glutathione S-t ( 220) 219 61.8 6.1e-07 hypothetical protein SPRG_11344 [Saprolegnia paras ( 221) 219 61.8 6.2e-07 ref|XP_003220232.1| PREDICTED: glutathione S-t ( 221) 219 61.8 6.2e-07 glutathione transferase class-sigma-like protein [ ( 198) 218 61.6 6.3e-07 hypothetical protein PPL_06751 [Polysphondylium pa ( 200) 218 61.6 6.4e-07 ref|XP_003386765.1| PREDICTED: glutathione S-t ( 201) 218 61.6 6.4e-07 hypothetical protein TRIVIDRAFT_59338 [Trichoderma ( 202) 218 61.6 6.5e-07 glutathione S-transferase sigma [Antheraea pernyi] ( 204) 218 61.6 6.6e-07 ref|XP_003514993.2| PREDICTED: glutathione S-t ( 264) 220 61.9 6.6e-07 ref|NP_001037077.1| glutathione S-transferase ( 206) 218 61.6 6.6e-07 ref|XP_007948668.1| PREDICTED: glutathione S-t ( 236) 219 61.8 6.7e-07 glutathione S-transferase alpha [Pseudopleuronecte ( 51) 207 59.5 6.8e-07 ref|XP_006979557.1| PREDICTED: glutathione S-t ( 185) 217 61.4 6.8e-07 hypothetical protein DAPPUDRAFT_205726 [Daphnia pu ( 214) 218 61.6 7e-07 ref|XP_005860173.1| PREDICTED: glutathione S-t ( 245) 219 61.7 7.1e-07 ref|XP_005732912.1| PREDICTED: glutathione S-t ( 217) 218 61.5 7.1e-07 unnamed protein product [Homo sapiens] ( 191) 217 61.4 7.1e-07 ref|XP_003479258.1| PREDICTED: glutathione S-t ( 218) 218 61.5 7.2e-07 ref|XP_007947811.1| PREDICTED: glutathione S-t ( 218) 218 61.5 7.2e-07 ref|XP_007975863.1| PREDICTED: glutathione S-t ( 218) 218 61.5 7.2e-07 ref|XP_005076674.1| PREDICTED: glutathione S-t ( 218) 218 61.5 7.2e-07 ref|XP_004637045.1| PREDICTED: glutathione S-t ( 225) 218 61.5 7.5e-07 sigma class glutathione S-transferase [Ruditapes p ( 203) 217 61.3 7.7e-07 ref|XP_003330219.1| hypothetical protein PGTG_ ( 205) 217 61.3 7.8e-07 ref|XP_005860174.1| PREDICTED: glutathione S-t ( 303) 220 61.9 7.9e-07 hypothetical protein AW11_02119 [Candidatus Accumu ( 207) 217 61.3 7.9e-07 glutathione S-transferase A [Ruditapes philippinar ( 210) 217 61.3 8.1e-07 glutathione S-transferase [Fasciola gigantica] ( 211) 217 61.3 8.1e-07 glutathione S-transferase sigma [Haliotis discus h ( 164) 215 60.9 8.2e-07 Maleylacetoacetate isomerase [Anoplopoma fimbria] ( 216) 217 61.3 8.4e-07 ref|XP_007947829.1| PREDICTED: glutathione S-t ( 216) 217 61.3 8.4e-07 pdb|6GSX|A Chain A, First-sphere And Second-sphe ( 217) 217 61.3 8.4e-07 ref|XP_004091914.1| PREDICTED: maleylacetoacet ( 217) 217 61.3 8.4e-07 ref|XP_004554297.1| PREDICTED: glutathione S-t ( 217) 217 61.3 8.4e-07 ref|XP_005973635.1| PREDICTED: glutathione S-t ( 218) 217 61.3 8.5e-07 ref|XP_005197841.1| PREDICTED: glutathione S-t ( 218) 217 61.3 8.5e-07 ref|XP_004620121.1| PREDICTED: glutathione S-t ( 218) 217 61.3 8.5e-07 ref|XP_003409602.1| PREDICTED: glutathione S-t ( 218) 217 61.3 8.5e-07 ref|XP_007619932.1| PREDICTED: glutathione S-t ( 218) 217 61.3 8.5e-07 ref|XP_002068731.1| GK17930 [Drosophila willis ( 250) 218 61.5 8.6e-07 ref|XP_006008525.1| PREDICTED: glutathione S-t ( 220) 217 61.3 8.6e-07 glutathione S-transferase M2 [synthetic construct] ( 220) 217 61.3 8.6e-07 glutathione S-transferase M2 [synthetic construct] ( 221) 217 61.3 8.6e-07 glutathione S-transferase mu4 [Tetranychus cinnaba ( 227) 217 61.3 8.9e-07 Glutathione S-transferase Mu 1 [Bos mutus] ( 234) 217 61.3 9.3e-07 maleylacetoacetate isomerase [Perca flavescens] ( 210) 216 61.1 9.6e-07 hypothetical protein CAPTEDRAFT_152305 [Capitella ( 211) 216 61.1 9.6e-07 glutathione S transferase [Hymenolepis microstoma] ( 212) 216 61.1 9.7e-07 hypothetical protein HMPREF1544_10622 [Mucor circi ( 213) 216 61.1 9.7e-07 putative: similar to glutathione S-transferase, pi ( 213) 216 61.1 9.7e-07 ref|XP_006092694.1| PREDICTED: glutathione S-t ( 243) 217 61.3 9.8e-07 hypothetical protein CAEBREN_17519 [Caenorhabditis ( 214) 216 61.1 9.8e-07 ref|XP_001015253.1| Glutathione S-transferase, ( 215) 216 61.1 9.9e-07 hypothetical protein OXYTRI_02382 [Oxytricha trifa ( 215) 216 61.1 9.9e-07 ref|XP_007530199.1| PREDICTED: maleylacetoacet ( 216) 216 61.1 9.9e-07 glutathione S-transferase mu 3 [Rattus norvegicus] ( 216) 216 61.1 9.9e-07 gluthathione S-transferase zeta [Takifugu obscurus ( 216) 216 61.1 9.9e-07 sigma glutathione S-transferase 2 [Ruditapes phili ( 217) 216 61.1 1e-06 glutathione S-transferase Yb-1 subunit (EC 2.5.1.1 ( 218) 216 61.1 1e-06 ref|XP_007529435.1| PREDICTED: glutathione S-t ( 218) 216 61.1 1e-06 ref|NP_001276887.1| glutathione S-transferase ( 218) 216 61.1 1e-06 ref|XP_006899386.1| PREDICTED: glutathione S-t ( 218) 216 61.1 1e-06 sp|Q9TSM5.3|GSTM1_MACFA RecName: Full=Glutathio ( 218) 216 61.1 1e-06 ref|XP_005003085.1| PREDICTED: glutathione S-t ( 286) 218 61.4 1e-06 Glutathione S-transferase P [Heterocephalus glaber ( 252) 217 61.2 1e-06 unnamed protein product [Albugo candida] ( 199) 215 60.9 1.1e-06 ref|XP_006979554.1| PREDICTED: glutathione S-t ( 184) 214 60.6 1.1e-06 ref|XP_005542505.1| PREDICTED: glutathione S-t ( 238) 216 61.0 1.1e-06 ref|XP_006813071.1| PREDICTED: hematopoietic p ( 162) 213 60.5 1.1e-06 glutathione S-transferase Mu 1-like protein [Crice ( 764) 225 62.7 1.1e-06 hypothetical protein CAEBREN_06644 [Caenorhabditis ( 214) 215 60.8 1.2e-06 glutathione S-transferase M2 (muscle) [Homo sapien ( 189) 214 60.6 1.2e-06 ref|XP_005732914.1| PREDICTED: glutathione S-t ( 215) 215 60.8 1.2e-06 ref|XP_003444864.1| PREDICTED: glutathione S-t ( 215) 215 60.8 1.2e-06 ref|XP_003314476.1| PREDICTED: LOW QUALITY PRO ( 216) 215 60.8 1.2e-06 Glutathione S-transferase Mu 1 [Myotis brandtii] ( 362) 219 61.6 1.2e-06 ref|XP_004055548.1| PREDICTED: maleylacetoacet ( 217) 215 60.8 1.2e-06 ref|NP_001135840.1| glutathione S-transferase ( 191) 214 60.6 1.2e-06 ref|XP_003515286.1| PREDICTED: glutathione S-t ( 218) 215 60.8 1.2e-06 ref|NP_001075721.1| glutathione S-transferase ( 218) 215 60.8 1.2e-06 mu-class glutathione S-transferase hGSTYBX - hamst ( 218) 215 60.8 1.2e-06 ref|XP_004582211.1| PREDICTED: glutathione S-t ( 218) 215 60.8 1.2e-06 ref|XP_004002338.1| PREDICTED: glutathione S-t ( 218) 215 60.8 1.2e-06 ref|XP_005367927.1| PREDICTED: glutathione S-t ( 218) 215 60.8 1.2e-06 ref|XP_004620123.1| PREDICTED: glutathione S-t ( 218) 215 60.8 1.2e-06 ref|XP_005338154.1| PREDICTED: glutathione S-t ( 218) 215 60.8 1.2e-06 ref|XP_005510501.1| PREDICTED: glutathione S-t ( 322) 218 61.4 1.2e-06 ref|XP_001020128.1| Glutathione S-transferase, ( 368) 219 61.5 1.2e-06 ref|XP_005338157.1| PREDICTED: glutathione S-t ( 251) 216 61.0 1.2e-06 ref|XP_002951502.1| hypothetical protein VOLCA ( 227) 215 60.8 1.3e-06 ref|XP_003395153.1| PREDICTED: glutathione S-t ( 201) 214 60.6 1.3e-06 ref|XP_005388951.1| PREDICTED: glutathione S-t ( 339) 218 61.3 1.3e-06 glutathione S-transferase, putative [Aspergillus o ( 207) 214 60.6 1.3e-06 ref|XP_009038195.1| hypothetical protein AURAN ( 214) 214 60.6 1.4e-06 ref|XP_003409598.1| PREDICTED: glutathione S-t ( 218) 214 60.6 1.4e-06 ref|XP_004582016.1| PREDICTED: glutathione S-t ( 218) 214 60.6 1.4e-06 ref|NP_032210.3| glutathione S-transferase Mu ( 218) 214 60.6 1.4e-06 ref|NP_001019475.1| glutathione S-transferase M ( 218) 214 60.6 1.4e-06 ref|XP_002407710.1| glutathione S-transferase, ( 249) 215 60.8 1.4e-06 ref|XP_004417832.1| PREDICTED: LOW QUALITY PRO ( 220) 214 60.6 1.4e-06 ref|XP_003918577.1| PREDICTED: glutathione S-t ( 220) 214 60.6 1.4e-06 hypothetical protein SPRG_11345 [Saprolegnia paras ( 221) 214 60.6 1.4e-06 EPS8-like protein [Camelus ferus] ( 702) 223 62.2 1.4e-06 ref|XP_004026331.1| PREDICTED: glutathione S-t ( 222) 214 60.6 1.4e-06 ref|XP_002594324.1| hypothetical protein BRAFL ( 196) 213 60.4 1.5e-06 ref|XP_004867440.1| PREDICTED: glutathione S-t ( 226) 214 60.6 1.5e-06 Glutathione S-transferase 3 [Crassostrea gigas] ( 137) 210 59.8 1.5e-06 Glutathione S-transferase Mu 1, partial [Stegodyph ( 207) 213 60.3 1.6e-06 ref|WP_004371111.1| glutathione S-transferase- ( 207) 213 60.3 1.6e-06 sp|P30114.1|GST28_SCHHA RecName: Full=Glutathione ( 211) 213 60.3 1.6e-06 glutathione S-transferase Y-b subunit (EC 2.5.1.18 ( 186) 212 60.2 1.6e-06 ref|XP_008064850.1| PREDICTED: glutathione S-t ( 243) 214 60.5 1.6e-06 ref|NP_001187810.1| glutathione S-transferase ( 214) 213 60.3 1.6e-06 ref|XP_785986.1| PREDICTED: maleylacetoacetate ( 214) 213 60.3 1.6e-06 ref|XP_003260846.1| PREDICTED: maleylacetoacet ( 216) 213 60.3 1.7e-06 ref|XP_008848595.1| PREDICTED: glutathione S-t ( 218) 213 60.3 1.7e-06 ref|XP_005614993.1| PREDICTED: LOW QUALITY PRO ( 218) 213 60.3 1.7e-06 ref|XP_004388074.1| PREDICTED: glutathione S-t ( 218) 213 60.3 1.7e-06 GSTM4, partial [synthetic construct] ( 218) 213 60.3 1.7e-06 ref|XP_007529434.1| PREDICTED: glutathione S-t ( 218) 213 60.3 1.7e-06 ref|XP_003962685.1| PREDICTED: maleylacetoacet ( 220) 213 60.3 1.7e-06 glutathione S-transferase Yb2 subunit, partial [Ra ( 194) 212 60.1 1.7e-06 ref|XP_006065041.1| PREDICTED: glutathione S-t ( 196) 212 60.1 1.7e-06 ref|XP_004904884.1| PREDICTED: LOW QUALITY PRO ( 224) 213 60.3 1.7e-06 ref|XP_002670102.1| glutathione-s-transferase ( 203) 212 60.1 1.8e-06 glutathione S-transferase sigma 4 [Spodoptera litu ( 204) 212 60.1 1.8e-06 Glutathione S-transferase Y1, partial [Crassostrea ( 204) 212 60.1 1.8e-06 Glutathione S-transferase Mu 3, partial [Cuculus c ( 206) 212 60.1 1.8e-06 ref|XP_002782852.1| Glutathione S-transferase, ( 211) 212 60.1 1.9e-06 glutathione S-transferase pi-class [Hyriopsis schl ( 127) 208 59.4 1.9e-06 ref|XP_004898475.1| PREDICTED: glutathione S-t ( 187) 211 59.9 1.9e-06 glutathione s-transferase zeta [Kryptolebias marmo ( 216) 212 60.1 2e-06 ref|XP_002810530.1| PREDICTED: glutathione S-t ( 218) 212 60.1 2e-06 ref|XP_003514990.1| PREDICTED: glutathione S-t ( 218) 212 60.1 2e-06 ref|XP_008059296.1| PREDICTED: glutathione S-t ( 218) 212 60.1 2e-06 glutathione S-transferase Mu 5-like protein [Crice ( 248) 213 60.3 2e-06 ref|WP_026129870.1| hypothetical protein [Stre ( 192) 211 59.9 2e-06 ref|XP_002801739.1| PREDICTED: glutathione S-t ( 220) 212 60.1 2e-06 ref|XP_001701095.1| glutathione S-transferase ( 221) 212 60.1 2e-06 glutathione S-transferase, mu 5, isoform CRA_b [Ra ( 172) 210 59.7 2e-06 ref|XP_002610393.1| hypothetical protein BRAFL ( 196) 211 59.9 2e-06 hypothetical protein EGK_01057 [Macaca mulatta] ( 223) 212 60.1 2e-06 hypothetical protein PPL_10987 [Polysphondylium pa ( 201) 211 59.9 2.1e-06 rCG28943, isoform CRA_b [Rattus norvegicus] ( 178) 210 59.7 2.1e-06 glutathione S-transferase [Danaus plexippus] ( 203) 211 59.9 2.1e-06 ref|WP_011758506.1| glutathione S-transferase ( 206) 211 59.9 2.2e-06 ref|XP_005715740.1| Glutathione S-transferase ( 209) 211 59.9 2.2e-06 ref|XP_005678000.1| PREDICTED: glutathione S-t ( 184) 210 59.7 2.2e-06 ref|XP_008604034.1| hypothetical protein SDRG_ ( 211) 211 59.8 2.2e-06 unnamed protein product [Oikopleura dioica] ( 240) 212 60.0 2.2e-06 unnamed protein product [Oikopleura dioica] ( 240) 212 60.0 2.2e-06 putative glutathione s-transferase gst-36 [Ascaris ( 164) 209 59.5 2.3e-06 hypothetical protein M514_02936 [Trichuris suis] ( 187) 210 59.7 2.3e-06 ref|XP_004055544.1| PREDICTED: maleylacetoacet ( 216) 211 59.8 2.3e-06 ref|XP_005916833.1| PREDICTED: maleylacetoacet ( 216) 211 59.8 2.3e-06 ref|XP_002825017.1| PREDICTED: maleylacetoacet ( 216) 211 59.8 2.3e-06 ref|XP_005732913.1| PREDICTED: glutathione S-t ( 217) 211 59.8 2.3e-06 ref|XP_009210295.1| PREDICTED: maleylacetoacet ( 217) 211 59.8 2.3e-06 ref|XP_005338152.1| PREDICTED: glutathione S-t ( 218) 211 59.8 2.3e-06 ref|XP_007975864.1| PREDICTED: glutathione S-t ( 218) 211 59.8 2.3e-06 ref|XP_006979549.1| PREDICTED: glutathione S-t ( 218) 211 59.8 2.3e-06 ref|XP_008564849.1| PREDICTED: glutathione S-t ( 218) 211 59.8 2.3e-06 ref|XP_008528310.1| PREDICTED: glutathione S-t ( 218) 211 59.8 2.3e-06 ref|XP_007529408.1| PREDICTED: glutathione S-t ( 218) 211 59.8 2.3e-06 ref|XP_004899219.1| PREDICTED: glutathione S-t ( 193) 210 59.6 2.4e-06 ref|XP_008876752.1| hypothetical protein H310_ ( 220) 211 59.8 2.4e-06 ref|XP_005916832.1| PREDICTED: maleylacetoacet ( 220) 211 59.8 2.4e-06 hypothetical protein EGM_00918 [Macaca fasciculari ( 220) 211 59.8 2.4e-06 ref|XP_009213101.1| PREDICTED: glutathione S-t ( 222) 211 59.8 2.4e-06 ref|XP_006627371.1| PREDICTED: hematopoietic p ( 199) 210 59.6 2.5e-06 hypothetical protein OXYTRI_20931 [Oxytricha trifa ( 227) 211 59.8 2.5e-06 Glutathione S-transferase 1, partial [Stegodyphus ( 201) 210 59.6 2.5e-06 hypothetical protein FOWG_15807 [Fusarium oxysporu ( 202) 210 59.6 2.5e-06 glutathione-S-transferase 1, partial [Laodelphax s ( 121) 206 58.9 2.5e-06 ref|XP_005197840.1| PREDICTED: glutathione S-t ( 204) 210 59.6 2.5e-06 Glutathione S-transferase Mu 5, partial [Struthio ( 181) 209 59.4 2.6e-06 ref|WP_011465539.1| glutathione S-transferase ( 206) 210 59.6 2.6e-06 ref|XP_007653426.1| PREDICTED: glutathione S-t ( 207) 210 59.6 2.6e-06 Glutathione S-transferase Mu 5, partial [Calypte a ( 161) 208 59.2 2.6e-06 hypothetical protein Y032_0007g3396 [Ancylostoma c ( 163) 208 59.2 2.7e-06 ref|XP_001027002.1| Glutathione S-transferase, ( 240) 211 59.8 2.7e-06 ref|XP_007624746.1| PREDICTED: maleylacetoacet ( 215) 210 59.6 2.7e-06 ref|XP_785800.2| PREDICTED: glutathione S-tran ( 278) 212 60.0 2.7e-06 ref|XP_007985586.1| PREDICTED: maleylacetoacet ( 216) 210 59.6 2.7e-06 ref|XP_003769787.1| PREDICTED: glutathione S-t ( 216) 210 59.6 2.7e-06 unnamed protein product [Oncorhynchus mykiss] ( 216) 210 59.6 2.7e-06 ref|XP_002631492.1| Hypothetical protein CBG20 ( 216) 210 59.6 2.7e-06 ref|NP_001274598.1| glutathione S-transferase ( 217) 210 59.6 2.8e-06 ref|XP_005914972.1| PREDICTED: glutathione S-t ( 217) 210 59.6 2.8e-06 ref|XP_672662.1| glutathione S-transferase [Pl ( 130) 206 58.9 2.8e-06 glutathione S-transferase mu 1 [Rattus norvegicus] ( 218) 210 59.6 2.8e-06 ref|XP_003892394.1| PREDICTED: glutathione S-t ( 218) 210 59.6 2.8e-06 ref|XP_008497717.1| PREDICTED: glutathione S-t ( 169) 208 59.2 2.8e-06 Glutathione S-transferase Mu 1, partial [Stegodyph ( 219) 210 59.6 2.8e-06 pdb|1GSU|A Chain A, An Avian Class-Mu Glutathion ( 219) 210 59.6 2.8e-06 glutathione S-transferase [Psoroptes ovis] ( 219) 210 59.6 2.8e-06 ref|NP_990421.1| glutathione S-transferase 2 [G ( 220) 210 59.6 2.8e-06 ref|XP_002610394.1| hypothetical protein BRAFL ( 197) 209 59.4 2.9e-06 Glutathione s-transferase [Oxytricha trifallax] ( 224) 210 59.6 2.9e-06 ref|XP_007472223.1| PREDICTED: LOW QUALITY PRO ( 226) 210 59.6 2.9e-06 ref|XP_003386762.1| PREDICTED: glutathione S-t ( 201) 209 59.4 3e-06 hypothetical protein CGI_10000124, partial [Crasso ( 177) 208 59.2 3e-06 ref|XP_008528315.1| PREDICTED: glutathione S-t ( 231) 210 59.6 3e-06 ref|XP_007256266.1| PREDICTED: glutathione S-t ( 179) 208 59.2 3e-06 ref|XP_007450087.1| PREDICTED: hematopoietic p ( 205) 209 59.4 3e-06 Glutathione S-transferase [Cerapachys biroi] ( 265) 211 59.7 3e-06 glutathione s-transferase 1 [Ascaris suum] ( 238) 210 59.5 3.1e-06 ref|XP_009163006.1| hypothetical protein T265_ ( 210) 209 59.4 3.1e-06 mCG144942, isoform CRA_b [Mus musculus] ( 211) 209 59.4 3.2e-06 UNKNOWN [Stylonychia lemnae] ( 213) 209 59.4 3.2e-06 sp|P27011.1|SCRY3_OCTDO RecName: Full=S-crystalli ( 215) 209 59.4 3.2e-06 ref|XP_004620125.1| PREDICTED: glutathione S-t ( 215) 209 59.4 3.2e-06 glutathione transferase zeta 1 (maleylacetoacetate ( 216) 209 59.3 3.3e-06 ref|XP_004540710.1| PREDICTED: maleylacetoacet ( 216) 209 59.3 3.3e-06 glutathione s transferase [Stylonychia lemnae] ( 217) 209 59.3 3.3e-06 ref|XP_006919672.1| PREDICTED: glutathione S-t ( 218) 209 59.3 3.3e-06 ref|XP_006263831.1| PREDICTED: maleylacetoacet ( 218) 209 59.3 3.3e-06 ref|NP_001272186.1| glutathione S-transferase ( 218) 209 59.3 3.3e-06 ref|NP_001073823.1| glutathione S-transferase ( 218) 209 59.3 3.3e-06 ref|XP_001960571.1| GF13422 [Drosophila ananas ( 249) 210 59.5 3.3e-06 ref|XP_002049497.1| GJ20716 [Drosophila virili ( 249) 210 59.5 3.3e-06 ref|XP_004540709.1| PREDICTED: maleylacetoacet ( 220) 209 59.3 3.3e-06 Glutathione S-transferase Mu 1, partial [Bos mutus ( 222) 209 59.3 3.4e-06 glutathione S-transferase mu1 [Panonychus citri] ( 224) 209 59.3 3.4e-06 ref|XP_008064849.1| PREDICTED: LOW QUALITY PRO ( 224) 209 59.3 3.4e-06 ref|XP_003729657.1| PREDICTED: S-crystallin SL ( 174) 207 59.0 3.4e-06 Hematopoietic prostaglandin D synthase, partial [B ( 174) 207 59.0 3.4e-06 unnamed protein product [Albugo candida] ( 199) 208 59.1 3.5e-06 ref|WP_020328856.1| glutathione S-transferase ( 202) 208 59.1 3.5e-06 Glutathione S-transferase 1 [Crassostrea gigas] ( 179) 207 58.9 3.6e-06 Glutathione S-transferase, putative [Oxytricha tri ( 342) 212 59.9 3.6e-06 ref|WP_018991463.1| hypothetical protein [Azoa ( 207) 208 59.1 3.6e-06 unnamed protein product [Tetraodon nigroviridis] ( 207) 208 59.1 3.6e-06 ref|XP_005007913.1| PREDICTED: glutathione S-t ( 184) 207 58.9 3.7e-06 glutathione s-transferase [Stylonychia lemnae] ( 211) 208 59.1 3.7e-06 ref|NP_665877.1| maleylacetoacetate isomerase i ( 216) 208 59.1 3.9e-06 ref|XP_005724114.1| PREDICTED: maleylacetoacet ( 216) 208 59.1 3.9e-06 ref|XP_004371130.1| PREDICTED: maleylacetoacet ( 216) 208 59.1 3.9e-06 ref|XP_006036016.1| PREDICTED: maleylacetoacet ( 218) 208 59.1 3.9e-06 ref|XP_001020126.1| Glutathione S-transferase, ( 218) 208 59.1 3.9e-06 ref|XP_004026332.1| PREDICTED: glutathione S-t ( 218) 208 59.1 3.9e-06 ref|XP_006065043.1| PREDICTED: glutathione S-t ( 218) 208 59.1 3.9e-06 ref|XP_002810526.1| PREDICTED: glutathione S-t ( 218) 208 59.1 3.9e-06 glutathione S-transferase Mu 7-like protein [Crice ( 698) 217 60.8 3.9e-06 ref|XP_002407711.1| glutathione S-transferase, ( 250) 209 59.3 3.9e-06 ref|XP_005724113.1| PREDICTED: maleylacetoacet ( 220) 208 59.1 3.9e-06 ref|XP_005530229.1| PREDICTED: glutathione S-t ( 220) 208 59.1 3.9e-06 ref|XP_003102855.1| CRE-GST-4 protein [Caenorh ( 222) 208 59.1 4e-06 ref|XP_008844334.1| PREDICTED: oocyte-expresse ( 371) 212 59.8 4e-06 glutathione S-transferase Mu 7-like protein [Crice ( 707) 217 60.8 4e-06 ref|XP_003108803.1| CRE-GST-20 protein [Caenor ( 223) 208 59.1 4e-06 ref|WP_028862842.1| glutathione S-transferase ( 197) 207 58.9 4e-06 unnamed protein product [Albugo candida] ( 201) 207 58.9 4.2e-06 hypothetical protein FOPG_12263 [Fusarium oxysporu ( 202) 207 58.9 4.2e-06 glutathionetransferase [Riptortus pedestris] ( 203) 207 58.9 4.2e-06 ref|XP_004332464.1| PREDICTED: LOW QUALITY PRO ( 158) 205 58.5 4.2e-06 allergen Aca s 8 [Acarus siro] ( 180) 206 58.7 4.3e-06 ref|XP_002919259.1| PREDICTED: glutathione S-t ( 205) 207 58.9 4.3e-06 ref|XP_005447184.1| PREDICTED: glutathione S-t ( 242) 208 59.1 4.5e-06 ref|XP_005099263.1| PREDICTED: glutathione S-t ( 216) 207 58.9 4.6e-06 glutathione transferase Zeta 1 [Homo sapiens] ( 216) 207 58.9 4.6e-06 ref|XP_006810482.1| PREDICTED: maleylacetoacet ( 216) 207 58.9 4.6e-06 ref|XP_003902151.1| PREDICTED: maleylacetoacet ( 216) 207 58.9 4.6e-06 ref|XP_006862554.1| PREDICTED: glutathione S-t ( 190) 206 58.7 4.6e-06 Maleylacetoacetate isomerase [Caligus rogercressey ( 218) 207 58.9 4.6e-06 sp|O35660.3|GSTM6_MOUSE RecName: Full=Glutathio ( 218) 207 58.9 4.6e-06 Glutathione S-transferase Mu 3 [Callorhinchus mili ( 219) 207 58.9 4.7e-06 Glutathione S-transferase Mu 3 [Callorhinchus mili ( 219) 207 58.9 4.7e-06 ref|XP_006810481.1| PREDICTED: maleylacetoacet ( 220) 207 58.9 4.7e-06 ref|XP_003220234.1| PREDICTED: glutathione S-t ( 220) 207 58.9 4.7e-06 ref|XP_001431217.1| hypothetical protein [Para ( 221) 207 58.8 4.7e-06 ref|XP_003479257.1| PREDICTED: glutathione S-t ( 222) 207 58.8 4.7e-06 glutathione-S-transferase [Bemisia tabaci] ( 172) 205 58.5 4.7e-06 glutathione S-transferase [Hypophthalmichthys moli ( 198) 206 58.7 4.8e-06 class gamma glutathione s-transferase [Lichtheimia ( 201) 206 58.6 4.9e-06 hypothetical protein FOMG_15148 [Fusarium oxysporu ( 202) 206 58.6 5e-06 glutathione S-transferase protein [Necator america ( 142) 203 58.1 5.2e-06 ref|XP_005905476.1| PREDICTED: hematopoietic p ( 184) 205 58.4 5.2e-06 ref|XP_005787446.1| hypothetical protein EMIHU ( 239) 207 58.8 5.2e-06 ref|XP_006678233.1| hypothetical protein BATDE ( 211) 206 58.6 5.2e-06 sp|P27012.1|SCRY4_OCTDO RecName: Full=S-crystalli ( 215) 206 58.6 5.4e-06 sp|O43708.3|MAAI_HUMAN RecName: Full=Maleylace ( 216) 206 58.6 5.4e-06 ref|XP_001101990.1| PREDICTED: maleylacetoacet ( 216) 206 58.6 5.4e-06 ref|XP_002938913.1| PREDICTED: maleylacetoacet ( 216) 206 58.6 5.4e-06 Glutathione S-transferase [Acromyrmex echinatior] ( 216) 206 58.6 5.4e-06 pdb|1FW1|A Chain A, Glutathione Transferase Zet ( 216) 206 58.6 5.4e-06 ref|XP_007638589.1| PREDICTED: maleylacetoacet ( 364) 210 59.4 5.5e-06 ref|NP_080948.2| glutathione S-transferase Mu ( 218) 206 58.6 5.5e-06 S-crystallin [Doryteuthis opalescens] ( 219) 206 58.6 5.5e-06 Glutathione S-transferase Mu 3 [Callorhinchus mili ( 219) 206 58.6 5.5e-06 ref|NP_001279473.1| glutathione S-transferase ( 219) 206 58.6 5.5e-06 Glutathione S-transferase Mu 3 [Anoplopoma fimbria ( 219) 206 58.6 5.5e-06 ref|XP_004070448.1| PREDICTED: glutathione S-t ( 219) 206 58.6 5.5e-06 ref|XP_001020130.1| Glutathione S-transferase, ( 219) 206 58.6 5.5e-06 Glutathione S-transferase, N-terminal domain conta ( 220) 206 58.6 5.5e-06 ref|XP_002138662.1| GA24907 [Drosophila pseudo ( 222) 206 58.6 5.6e-06 glutathione-S-transferase [Bemisia tabaci] ( 172) 204 58.2 5.6e-06 glutathione Stransferase putative [Albugo laibachi ( 199) 205 58.4 5.8e-06 ref|XP_007975860.1| PREDICTED: glutathione S-t ( 177) 204 58.2 5.8e-06 Glutathione S-transferase s3 protein [Oxytricha tr ( 341) 209 59.1 5.9e-06 ref|XP_007975862.1| PREDICTED: glutathione S-t ( 205) 205 58.4 6e-06 ref|XP_002647334.1| Hypothetical protein CBG06 ( 160) 203 58.0 6.1e-06 ref|XP_001822254.1| glutathione S-transferase ( 207) 205 58.4 6.1e-06 hypothetical protein Csp_B19650 [Curvibacter putat ( 207) 205 58.4 6.1e-06 ref|XP_002382337.1| glutathione S-transferase, ( 207) 205 58.4 6.1e-06 Glutathione S-transferase Mu 2 [Heterocephalus gla ( 236) 206 58.6 6.1e-06 ref|XP_005367912.1| PREDICTED: glutathione S-t ( 184) 204 58.2 6.1e-06 ref|XP_008864512.1| hypothetical protein H310_ ( 211) 205 58.4 6.2e-06 gluthatione S-transferase [Araneus ventricosus] ( 215) 205 58.4 6.4e-06 ref|XP_007939528.1| PREDICTED: maleylacetoacet ( 216) 205 58.4 6.4e-06 ref|XP_008838231.1| PREDICTED: maleylacetoacet ( 216) 205 58.4 6.4e-06 ref|XP_006157141.1| PREDICTED: maleylacetoacet ( 217) 205 58.4 6.4e-06 glutathione-S-transferase class M5 [Mus musculus] ( 218) 205 58.4 6.5e-06 pdb|1C72|A Chain A, Tyr115, Gln165 And Trp209 C ( 219) 205 58.4 6.5e-06 Glutathione S-transferase Mu 3 [Callorhinchus mili ( 219) 205 58.4 6.5e-06 ref|XP_003220235.1| PREDICTED: glutathione S-t ( 220) 205 58.4 6.6e-06 ref|XP_005184664.1| PREDICTED: glutathione S-t ( 223) 205 58.4 6.7e-06 hypothetical protein RFI_11066 [Reticulomyxa filos ( 227) 205 58.3 6.8e-06 ref|WP_020023858.1| hypothetical protein [gamm ( 230) 205 58.3 7e-06 glutathione S transferase [Echinococcus multilocul ( 180) 203 58.0 7.1e-06 ref|XP_003325990.1| hypothetical protein PGTG_ ( 205) 204 58.2 7.1e-06 hypothetical protein EGK_01058 [Macaca mulatta] ( 237) 205 58.3 7.2e-06 ref|XP_003731001.1| PREDICTED: S-crystallin SL ( 125) 200 57.4 7.3e-06 sp|P30113.2|GST28_SCHBO RecName: Full=Glutathione ( 211) 204 58.1 7.4e-06 sp|P09792.1|GST28_SCHMA RecName: Full=Glutathione ( 211) 204 58.1 7.4e-06 hypothetical protein M91_01613 [Bos mutus] ( 241) 205 58.3 7.4e-06 28kDa glutathione-S transferase [Schistosoma haema ( 212) 204 58.1 7.4e-06 ref|XP_008848600.1| PREDICTED: glutathione S-t ( 243) 205 58.3 7.5e-06 glutathione S-transferase [Homo sapiens] ( 189) 203 57.9 7.5e-06 ref|XP_004371129.1| PREDICTED: maleylacetoacet ( 217) 204 58.1 7.6e-06 Maleylacetoacetate isomerase [Caligus rogercressey ( 218) 204 58.1 7.7e-06 ref|XP_002288258.1| glutathione s-transferase ( 218) 204 58.1 7.7e-06 ref|XP_006899381.1| PREDICTED: glutathione S-t ( 218) 204 58.1 7.7e-06 S-crystallin, partial [Doryteuthis opalescens] ( 222) 204 58.1 7.9e-06 ref|XP_005093139.1| PREDICTED: probable glutat ( 119) 199 57.2 8.1e-06 hypothetical protein FOTG_10544 [Fusarium oxysporu ( 202) 203 57.9 8.2e-06 mCG127140 [Mus musculus] ( 181) 202 57.7 8.4e-06 ref|NP_001153883.1| glutathione S-transferase ( 184) 202 57.7 8.6e-06 ref|XP_009000097.1| PREDICTED: LOW QUALITY PRO ( 241) 204 58.1 8.8e-06 ref|XP_004879128.1| PREDICTED: glutathione S-t ( 188) 202 57.7 8.9e-06 LOC496168 protein, partial [Xenopus laevis] ( 214) 203 57.9 8.9e-06 ref|NP_001088856.1| glutathione S-transferase ( 216) 203 57.9 9e-06 ref|XP_001367277.1| PREDICTED: maleylacetoacet ( 217) 203 57.9 9.1e-06 ref|NP_001102662.1| glutathione S-transferase ( 218) 203 57.9 9.1e-06 ref|XP_004845098.1| PREDICTED: glutathione S-t ( 218) 203 57.9 9.1e-06 ref|XP_004026337.1| PREDICTED: glutathione S-t ( 218) 203 57.9 9.1e-06 unnamed protein product [Mus musculus] ( 218) 203 57.9 9.1e-06 hypothetical protein F443_06641, partial [Phytopht ( 150) 200 57.3 9.2e-06 ref|XP_003409603.1| PREDICTED: glutathione S-t ( 199) 202 57.7 9.6e-06 ref|XP_009046703.1| hypothetical protein LOTGI ( 154) 200 57.3 9.6e-06 ref|XP_004332365.1| PREDICTED: LOW QUALITY PRO ( 227) 203 57.9 9.6e-06 ref|XP_004769773.1| PREDICTED: glutathione S-t ( 228) 203 57.9 9.7e-06 ref|XP_009196865.1| PREDICTED: glutathione S-t ( 177) 201 57.5 9.7e-06 pdb|2DC5|A Chain A, Crystal Structure Of Mouse ( 231) 203 57.9 9.8e-06 hypothetical protein PHYSODRAFT_466681 [Phytophtho ( 299) 205 58.2 9.9e-06 >>glutathione S-transferase Ya subunit [Rattus norvegicu (222 aa) initn: 1442 init1: 1442 opt: 1442 Z-score: 1912.0 bits: 361.0 E(49814966): 5.4e-97 Smith-Waterman score: 1442; 99.5% identity (100.0% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: glutat MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: glutat DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::: glutat TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNKLTRVDIHLLELLLYVEEFDASLLTSFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF :::::::::::::::::::::::::::::::::::::::::: glutat LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF 190 200 210 220 >>ref|NP_058709.2| glutathione S-transferase (222 aa) initn: 1440 init1: 1440 opt: 1440 Z-score: 1909.4 bits: 360.5 E(49814966): 7.6e-97 Smith-Waterman score: 1440; 99.5% identity (100.0% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ref|NP MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ref|NP DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ref|NP TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF :::::::::::::::::::::::::::.:::::::::::::: ref|NP LKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF 190 200 210 220 >>pdb|1EV9|A Chain A, Rat Glutathione S-Tran (221 aa) initn: 1418 init1: 1418 opt: 1418 Z-score: 1880.3 bits: 355.1 E(49814966): 3.1e-95 Smith-Waterman score: 1418; 98.6% identity (100.0% similar) in 221 aa overlap (2-222:1-221) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :::::::::::::::::::.::::::::::::::::::::::::::::::::::::::: pdb|1E SGKPVLHYFNARGRMECIRFLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::: pdb|1E DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIMQLVICPPDQKEAK 60 70 80 90 100 110 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::: pdb|1E TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNKLTRVDIHLLELLLYVEEFDASLLTSFPL 120 130 140 150 160 170 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF :::::::::::::::::::::::::::::::::::::::::: pdb|1E LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF 180 190 200 210 220 >>pdb|1EV4|A Chain A, Rat Glutathione S-tran (221 aa) initn: 1414 init1: 1414 opt: 1414 Z-score: 1875.0 bits: 354.1 E(49814966): 6.2e-95 Smith-Waterman score: 1414; 98.2% identity (100.0% similar) in 221 aa overlap (2-222:1-221) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :::::::::::::::::::.::::::::::::::::::::::::::::::::::::::: pdb|1E SGKPVLHYFNARGRMECIRFLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::: pdb|1E DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIMQLVICPPDQKEAK 60 70 80 90 100 110 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::: pdb|1E TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNKLTRVDIHLLELLLYVEEFDASLLTSFPL 120 130 140 150 160 170 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF :::::::::::::::::::::::::::::::::::::::.:: pdb|1E LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIYKF 180 190 200 210 220 >>sp|P04903.2|GSTA2_RAT RecName: Full=Glutathi (222 aa) initn: 1401 init1: 1401 opt: 1401 Z-score: 1857.8 bits: 350.9 E(49814966): 5.6e-94 Smith-Waterman score: 1401; 96.4% identity (99.1% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI ::::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::: sp|P04 MSGKPVLHYFNARGRMECIRWLLAAAGVEFEEKLIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::.::::::::::.:::::::::.::: sp|P04 DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIIQLVICPPDQREAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: sp|P04 TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :::::::::::.::: sp|P04 LKAFKSRISSLPNVKKFLQPGSQRKPAMDAKQIEEARKVFKF 190 200 210 220 >>ref|NP_001010921.1| glutathione S-transfer (222 aa) initn: 1395 init1: 1395 opt: 1395 Z-score: 1849.9 bits: 349.5 E(49814966): 1.6e-93 Smith-Waterman score: 1395; 95.9% identity (98.6% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI ::::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::: ref|NP MSGKPVLHYFNARGRMECIRWLLAAAGVEFEEKLIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::.::::::::::.:::::::::.::: ref|NP DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIIQLVICPPDQREAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::: ref|NP TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :::::::::::.::: ref|NP LKAFKSRISSLPNVKKFLQPGSQRKPAMDAKQIEEARKVFKF 190 200 210 220 >>glutathione transferase (EC 2.5.1.18) [Mus musculus] (222 aa) initn: 1387 init1: 1387 opt: 1387 Z-score: 1839.3 bits: 347.5 E(49814966): 6.1e-93 Smith-Waterman score: 1387; 94.6% identity (98.6% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.::::::::::::::::::::::::::::.::::::::::::::::::::::::::::: glutat MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::.:::::::::::::::::::::::::::::::::::::::: :::.:::::.::: glutat DGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::::::::::::::::::.:::::::::::.:::::: ::: glutat TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :.::::::::::.::: glutat LKAFKSRISSLPNVKKFLQPGSQRKPPLDAKQIEEARKVFKF 190 200 210 220 >>mCG129934, isoform CRA_a [Mus musculus] (222 aa) initn: 1383 init1: 1383 opt: 1383 Z-score: 1834.0 bits: 346.5 E(49814966): 1.2e-92 Smith-Waterman score: 1383; 94.6% identity (98.6% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.::::::.:::::::::::::::::::::.::::::::::::::::::::::::::::: mCG129 MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::.:::::::::::::::::::::::::::::.:::::::::: ::.:::::::::: mCG129 DGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLLICPPDQKEAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::.:::::::::::::::.:::::::::::::::::: ::: mCG129 TALAKDRTKNRYLPAFEKVLKGHGQDYLVGNRLTRVDVHLLELLLYVEEFDASLLTPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :.:::::::::::::: mCG129 LKAFKSRISSLPNVKKFLQPGSQRKPPLDAKQIEEARKIFKF 190 200 210 220 >>ENSMUSG00000074179 protein [Mus musculus] (222 aa) initn: 1382 init1: 1382 opt: 1382 Z-score: 1832.7 bits: 346.3 E(49814966): 1.4e-92 Smith-Waterman score: 1382; 94.1% identity (98.6% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.::::::.:::::::::::::::::::::.::::::::::::::::::::::::::::: ENSMUS MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::.:::::::::::::::::::::::::::::.:::::::::: ::.:::::::::: ENSMUS DGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLLICPPDQKEAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::.:::::::::::::::.:::::::::::::::::: ::: ENSMUS TALAKDRTKNRYLPAFEKVLKGHGQDYLVGNRLTRVDVHLLELLLYVEEFDASLLTPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :.::::::::::.::: ENSMUS LKAFKSRISSLPNVKKFLQPGSQRKPPLDAKQIEEARKVFKF 190 200 210 220 >>ref|NP_032208.2| glutathione S-transferase (222 aa) initn: 1381 init1: 1381 opt: 1381 Z-score: 1831.4 bits: 346.0 E(49814966): 1.7e-92 Smith-Waterman score: 1381; 94.1% identity (98.6% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.::::::::::::::::::::::::::::.::::::::::::::::::::::::::::: ref|NP MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::.:::::::::::::::::::::::::::::::::::::::: :::.:::::.::: ref|NP DGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::::::::::::::::::.:::::::::::.:::::: ::: ref|NP TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::.:::::: :.::::::::::.::: ref|NP LKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKVFKF 190 200 210 220 >>ref|NP_032207.3| glutathione S-transferas (223 aa) initn: 1380 init1: 1380 opt: 1380 Z-score: 1830.0 bits: 345.8 E(49814966): 2e-92 Smith-Waterman score: 1380; 95.0% identity (98.2% similar) in 221 aa overlap (1-221:1-221) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.::::::::::::::::::::::::::::.::::::::::::::::::::::::::::: ref|NP MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::.:::::::::: :::.:::::.::: ref|NP DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL ::::::::::::::::::::::::::::::::::::::::::.::::::::::::: ::: ref|NP TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :::::::.:::: :: ref|NP LKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ 190 200 210 220 >>ref|NP_001116132.1| uncharacterized prote (222 aa) initn: 1377 init1: 1377 opt: 1377 Z-score: 1826.1 bits: 345.1 E(49814966): 3.3e-92 Smith-Waterman score: 1377; 94.1% identity (98.6% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.::::::.:::::::::::::::::::::.::::::::::::::::::::::::::::: ref|NP MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::.:::::::::::::::::::::::::::::.:::::::::: ::.:::::::::: ref|NP DGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLLICPPDQKEAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::.:::::::::::::::.:::::::::::::::::: ::: ref|NP TALAKDRTKNRYLPAFEKVLKGHGQDYLVGNRLTRVDVHLLELLLYVEEFDASLLTPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::.:::::: :.:::::::::::::: ref|NP LKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKIFKF 190 200 210 220 >>glutathione S transferase [Mus musculus] (223 aa) initn: 1375 init1: 1375 opt: 1375 Z-score: 1823.4 bits: 344.6 E(49814966): 4.7e-92 Smith-Waterman score: 1375; 94.6% identity (98.2% similar) in 221 aa overlap (1-221:1-221) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.:::::::::::::::::::::::.::::.::::::::::::::::::::::::::::: glutat MAGKPVLHYFNARGRMECIRWLLAAGGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::.:::::::::: :::.:::::.::: glutat DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL ::::::::::::::::::::::::::::::::::::::::::.::::::::::::: ::: glutat TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :::::::.:::: :: glutat LKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ 190 200 210 220 >>ref|NP_001230021.1| predicted gene 3776 [ (223 aa) initn: 1374 init1: 1374 opt: 1374 Z-score: 1822.1 bits: 344.3 E(49814966): 5.5e-92 Smith-Waterman score: 1374; 94.6% identity (98.2% similar) in 221 aa overlap (1-221:1-221) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.::::::.:::::::::::::::::::::.::::::::::::::::::::::::::::: ref|NP MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::.:::::::::: :::.:::::.::: ref|NP DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL ::::::::::::::::::::::::::::::::::::::::::.::::::::::::: ::: ref|NP TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :::::::.:::: :: ref|NP LKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ 190 200 210 220 >>pdb|1F3A|A Chain A, Crystal Structure Of M (222 aa) initn: 1373 init1: 1373 opt: 1373 Z-score: 1820.8 bits: 344.1 E(49814966): 6.5e-92 Smith-Waterman score: 1373; 95.0% identity (98.2% similar) in 220 aa overlap (2-221:1-220) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI .::::::::::::::::::::::::::::.::::::::::::::::::::::::::::: pdb|1F AGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::.:::::::::: :::.:::::.::: pdb|1F DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAK 60 70 80 90 100 110 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL ::::::::::::::::::::::::::::::::::::::::::.::::::::::::: ::: pdb|1F TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPL 120 130 140 150 160 170 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :::::::.:::: :: pdb|1F LKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ 180 190 200 210 220 >>pdb|1ML6|A Chain A, Crystal Structure Of M (221 aa) initn: 1365 init1: 1365 opt: 1365 Z-score: 1810.2 bits: 342.1 E(49814966): 2.5e-91 Smith-Waterman score: 1365; 94.1% identity (98.2% similar) in 221 aa overlap (2-222:1-221) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI .::::::::::::::::::::::::::::.::::::::::::::::::::::::::::: pdb|1M AGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::.:::::::::::::::::::::::::::::::::::::::: :::. ::::.::: pdb|1M DGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLXPPDQREAK 60 70 80 90 100 110 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL :::::::::::::::::::::::::::::::::::::.:::::::::::.:::::: ::: pdb|1M TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPL 120 130 140 150 160 170 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :.::::::::::.::: pdb|1M LKAFKSRISSLPNVKKFLQPGSQRKPPLDAKQIEEARKVFKF 180 190 200 210 220 >>pdb|1F3B|A Chain A, Crystal Structure Of M (222 aa) initn: 1358 init1: 1358 opt: 1358 Z-score: 1800.9 bits: 340.4 E(49814966): 8.3e-91 Smith-Waterman score: 1358; 94.5% identity (97.7% similar) in 220 aa overlap (2-221:1-220) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI .::::::::::::::::::::::::::::.::::::::::::::::::::::::::::: pdb|1F AGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI 10 20 30 40 50 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK :::::::::::::::::::::::::::::::::::.:::::::::: :::. ::::.::: pdb|1F DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLXPPDQREAK 60 70 80 90 100 110 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL ::::::::::::::::::::::::::::::::::::::::::.::::::::::::: ::: pdb|1F TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPL 120 130 140 150 160 170 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF ::::::::::::::::::::::::: :::::::.:::: :: pdb|1F LKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ 180 190 200 210 220 >>ref|XP_006996952.1| PREDICTED: glutathion (222 aa) initn: 1305 init1: 1305 opt: 1305 Z-score: 1730.9 bits: 327.4 E(49814966): 6.6e-87 Smith-Waterman score: 1305; 87.4% identity (97.3% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.::::::::.:::::::::::::::::::.::::. :::::::.:::.:::.::::::: ref|XP MAGKPVLHYFKARGRMECIRWLLAAAGVEFEEKFIECPEDLEKLRKDGKLMFEQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK ::: ..:::::::::::::.:::::.:::::::::::::.:::::::::.:::::::::: ref|XP DGMIMVQTRAILNYIATKYNLYGKDVKERALIDMYTEGIVDLTEMIMQLIICPPDQKEAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL .. ::::::::::::::::::::::::::::::::::::::::::.::.:.:::. ::: ref|XP ISMIKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYIEELDSSLLAPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF :::.:::.::::::::::::::::: :.:::::::::::::: ref|XP LKALKSRLSSLPNVKKFLQPGSQRKPPLDAKQIEEARKIFKF 190 200 210 220 >>ref|XP_006996951.1| PREDICTED: glutathion (222 aa) initn: 1295 init1: 1295 opt: 1295 Z-score: 1717.7 bits: 325.0 E(49814966): 3.6e-86 Smith-Waterman score: 1295; 86.0% identity (97.3% similar) in 222 aa overlap (1-222:1-222) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.:::::::::.::::::::::::::::::.::::. :::::::.:::.:::.::::::: ref|XP MAGKPVLHYFNGRGRMECIRWLLAAAGVEFEEKFIERPEDLEKLRKDGKLMFEQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK ::: :.:::::::::::::::::::.:::::::::::::.:.::::.::..::::::::: ref|XP DGMILVQTRAILNYIATKYDLYGKDVKERALIDMYTEGIVDVTEMILQLILCPPDQKEAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL .. ::.:::::::::::::::::::::::::::::::::::::::.::.:.:::. ::: ref|XP ISMIKDKTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYIEELDSSLLAPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF :::.:::.::::::::::::::::: :.::::::::::.::: ref|XP LKALKSRLSSLPNVKKFLQPGSQRKPPVDAKQIEEARKMFKF 190 200 210 220 >>ref|XP_006995154.1| PREDICTED: LOW QUALIT (223 aa) initn: 1277 init1: 1277 opt: 1277 Z-score: 1693.8 bits: 320.6 E(49814966): 7.7e-85 Smith-Waterman score: 1277; 86.4% identity (96.8% similar) in 220 aa overlap (1-220:1-220) 10 20 30 40 50 60 XURTG MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI :.::::::::::::.:::::::::::::::.::::. :::::::.:::.::::::::::: ref|XP MAGKPVLHYFNARGKMECIRWLLAAAGVEFEEKFIERPEDLEKLRKDGKLMFDQVPMVEI 10 20 30 40 50 60 70 80 90 100 110 120 XURTG DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK ::: :.:::::::::::::::::::.:::::::.:::::::::::..::. ::::::::: ref|XP DGMTLVQTRAILNYIATKYDLYGKDVKERALIDIYTEGILDLTEMFIQLAKCPPDQKEAK 70 80 90 100 110 120 130 140 150 160 170 180 XURTG TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL .. :::::::::::::::::::::: :::::::::::::::::::.::::::::. ::: ref|XP ISMIKDRTKNRYLPAFEKVLKSHGQDXLVGNRLTRVDIHLLELLLYIEEFDASLLAPFPL 130 140 150 160 170 180 190 200 210 220 XURTG LKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIFKF :::.:::.::::.::::::::::::::..::::::..::: ref|XP LKALKSRLSSLPSVKKFLQPGSQRKLPLNAKQIEEGKKIFNIK 190 200 210 220 222 residues in 1 query sequences 17878177349 residues in 49814966 library sequences Tcomplib [36.3.6 Aug., 2014(preload9)] (64 proc) start: Tue Sep 30 12:46:49 2014 done: Tue Sep 30 12:49:55 2014 Total Scan time: 1052.690 Total Display time: 0.130 Function used was FASTA [36.3.6 Aug., 2014(preload9)]