# ssearch3.bin -k 500 -z 1 -m 0 -E 0.01 bio6278841360627469717.tmp.seq1 bio6278841360627469717.tmp.seq2
SSEARCH searches a sequence data bank
 version 35.04 Oct. 7, 2008
Please cite:
 T. F. Smith and M. S. Waterman, (1981) J. Mol. Biol. 147:195-197; 
 W.R. Pearson (1991) Genomics 11:635-650

Query: bio6278841360627469717.tmp.seq1
  1>>>ANP11_MACAM 62 bp - 62 aa
Library: bio6278841360627469717.tmp.seq2      91 residues in     1 sequences

     91 residues in     1 sequences
Statistics: (shuffled [500]) MLE statistics: Lambda= 0.2059;  K= 0.148
Algorithm: Smith-Waterman (PGopt) (6.0 Mar 2007)
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 Scan time:  0.070

The best scores are:                                      s-w bits E(1)
ANP3_MACAM 91 bp                                   (  91)  214 66.3 6.1e-17

>>ANP3_MACAM 91 bp                                        (91 aa)
 s-w opt: 214  Z-score: 336.6  bits: 66.3 E(): 6.1e-17
Smith-Waterman score: 214; 60.0% identity (75.0% similar) in 60 aa overlap (1-60:25-84)

                                       10        20        30      
ANP11_                         SVVATQLIPINTALTPAMMEGKVTNPIGIPFAEMSQ
                               ::::::::::::::: .::  .:  : :::  .. .
ANP3_M MKSVILTGLLFVLLCVDHMSSANQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPR
               10        20        30        40        50        60

         40        50        60       
ANP11_ IVGKQVNRIVAKGQTLMPNMVKTYAA     
       .:. :::. :  : ::::.::: :       
ANP3_M LVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN
               70        80        90 



62 residues in 1 query   sequences
91 residues in 1 library sequences
 Scomplib [35.04]
 start: Mon Sep 28 12:55:03 2009 done: Mon Sep 28 12:55:03 2009
 Total Scan time:  0.070 Total Display time:  0.000

Function used was SSEARCH [version 35.04 Oct. 7, 2008]