Content-type: text/html Manpage of FASTS/TFASTSv3

FASTS/TFASTSv3

Section: User Commands (1)
Updated: local
Index Return to Main Contents

NAME

fasts3, fasts3_t - compare several short peptide sequences against a protein database using a modified fasta algorithm.

tfasts3, tfasts3_t - compare short pepides against a translated DNA database.

DESCRIPTION

fasts3 and tfasts3 are designed to compare set of (presumably non-contiguous) peptides to a protein (fasts3) or translated DNA (tfasts3) database. fasts3/tfasts3 are designed particularly for short peptide data from mass-spec analysis of protein digests. Unlike the traditional fasta3 search, which uses a protein or DNA sequence, fasts3 and tfasts3 work with a query sequence of the form:

>tests from mgstm1
MLLE,
MILGYW,
MGADP,
MLCYNP

This sequence indicates that four peptides are to be used. When this sequence is compared against mgstm1.aa (included with the distribution), the result is:

testf    MILGYW----------MLLE------------MGDAP-----------
         ::::::          ::::            :::::           
GT8.7  MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEK
               10        20        30        40        50

testf  --------------------------------------------------
                                                         
GT8.7  FKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIV
               60        70        80        90       100

                      20                                 
testf  ------------MLCYNP
                   ::::::
GT8.7  ENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAG
              110       120       130       140       150

Options

fasts3 and tfasts3 can accept a query sequence from the unix "stdin" data stream. This makes it much easier to use fasta3 and its relatives as part of a WWW page. To indicate that stdin is to be used, use "-" or "@" as the query sequence file name.

-b #: number of best scores to show (must be < -E cutoff)
-d #: number of best alignments to show ( must be < -E cutoff)
-D: turn on debugging mode. Enables checks on sequence alphabet that cause problems with tfastx3, tfasty3, tfasta3.
-E #: Expectation value limit for displaying scores and alignments. Expectation values for fasts3 and tfasts3 are not as accurate as those for the other fasta3 programs.
-H: turn off histogram display
-i: compare against only the reverse complement of the library sequence.
-L: report long sequence description in alignments
-m 0,1,2,3,4,5,6,9,10: alignment display options
-N #: break long library sequences into blocks of # residues. Useful for bacterial genomes, which have only one sequence entry. -N 2000 works well for well for bacterial genomes.
-O file: send output to file
-q/-Q: quiet option; do not prompt for input
-R file: save all scores to statistics file
-S #: offset substitution matrix values by a constant #
-s name: specify substitution matrix. BLOSUM50 is used by default; PAM250, PAM120, and BLOSUM62 can be specified by setting -s P120, P250, or BL62. With this version, many more scoring matrices are available, including BLOSUM80 (BL80), and MDM_10, MDM_20, MDM_40 (M10, M20, M40). Alternatively, BLASTP1.4 format scoring matrix files can be specified.
-T #: (threaded, parallel only) number of threads or workers to use (set by default to 4 at compile time).
-t #: Translation table - tfasts3 can use the BLAST tranlation tables. See http://www.ncbi.nih.gov/htbin-post/Taxonomy/wprintgc?mode=c/.
-w #: line width for similarity score, sequence alignment, output.
-x "#,#": offsets query, library sequence for numbering alignments
-z #: Specify statistical calculation. Default is -z 1, which uses regression against the length of the library sequence. -z 0 disables statistics. -z 2 uses the ln() length correction. -z 3 uses Altschul and Gish's statistical estimates for specific protein BLOSUM scoring matrices and gap penalties. -z 4: an alternate regression method.
-Z db_size: Set the apparent database size used for expectation value calculations.
-3: (TFASTS3 only) use only forward frame translations

Environment variables:

FASTLIBS: location of library choice file (-l FASTLIBS)
SMATRIX: default scoring matrix (-s SMATRIX)
SRCH_URL: the format string used to define the option to re-search the database.
REF_URL: the format string used to define the option to lookup the library sequence in entrez, or some other database.

AUTHOR

Bill Pearson
wrp@virginia.EDU

This document was created by man2html, using the manual pages.
Time: 20:15:17 GMT, September 30, 2014