>P1;CCHU
cytochrome c - human
C;Species: Homo sapiens (man)
C;Date: 24-Apr-1984 #sequence_revision 30-Sep-1991 #text_change 28-Jun-1999
C;Accession: A31764; A05676; I55192; A00001
R;Evans, M.J.; Scarpulla, R.C.
Proc. Natl. Acad. Sci. U.S.A. 85, 9625-9629, 1988
A;Title: The human somatic cytochrome c gene: two classes of processed pseudogenes demarcate a period of rapid molecular evolution.
A;Reference number: A31764; MUID:89071748
A;Accession: A31764
A;Molecule type: DNA
A;Residues: 1-105 <EVA>
A;Cross-references: GB:M22877; NID:g181241; PIDN:AAA35732.1; PID:g181242
R;Matsubara, H.; Smith, E.L.
J. Biol. Chem. 238, 2732-2753, 1963
A;Title: Human heart cytochrome c. Chymotryptic peptides, tryptic peptides, and the complete amino acid sequence.
A;Reference number: A05676
A;Accession: A05676
A;Molecule type: protein
A;Residues: 2-28;29-46;47-100;101-105 <MATS>
R;Matsubara, H.; Smith, E.L.
J. Biol. Chem. 237, 3575-3576, 1962
A;Title: The amino acid sequence of human heart cytochrome c.
A;Reference number: A00001
A;Contents: annotation
A;Note: 66-Leu is found in 10% of the molecules in pooled protein
R;Tanaka, Y.; Ashikari, T.; Shibano, Y.; Amachi, T.; Yoshizumi, H.; Matsubara, H.
J. Biochem. 103, 954-961, 1988
A;Title: Construction of a human cytochrome c gene and its functional expression in Saccharomyces cerevisiae.
A;Reference number: I55192; MUID:89008207
A;Accession: I55192
A;Status: translated from GB/EMBL/DDBJ
A;Molecule type: mRNA
A;Residues: 78-105 <RES>
A;Cross-references: GB:D00265; NID:g2897691; PIDN:BAA00187.1; PID:d1000635; PID:g219557
C;Genetics:
A;Introns: 57/1
C;Superfamily: cytochrome c; cytochrome c homology
C;Keywords: acetylated amino end; chromoprotein; electron transfer; heme; iron; mitochondrion; oxidative phosphorylation; polymorphism; respiratory chain
F;2-105/Product: cytochrome c #status experimental <MAT>
F;5-99/Domain: cytochrome c homology <CYC>
F;2/Modified site: acetylated amino end (Gly) (in mature form) #status experimental
F;15,18/Binding site: heme (Cys) (covalent) #status experimental
F;19,81/Binding site: heme iron (His, Met) (axial ligands) #status predicted
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE