# Copyright 2003 Yair Benita. All rights reserved. # This file is part of the Biopython distribution and governed by your # choice of the "Biopython License Agreement" or the "BSD 3-Clause License". # Please see the LICENSE file that should have been included as part of this # package. """Simple protein analysis. Example: >>> from Bio.SeqUtils.ProtParam import ProteinAnalysis >>> X = ProteinAnalysis("MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGT" ... "RDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEEC" ... "LFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILF" ... "LPLPV") >>> print(X.count_amino_acids()['A']) 6 >>> print(X.count_amino_acids()['E']) 12 >>> print("%0.2f" % X.get_amino_acids_percent()['A']) 0.04 >>> print("%0.2f" % X.get_amino_acids_percent()['L']) 0.12 >>> print("%0.2f" % X.molecular_weight()) 17103.16 >>> print("%0.2f" % X.aromaticity()) 0.10 >>> print("%0.2f" % X.instability_index()) 41.98 >>> print("%0.2f" % X.isoelectric_point()) 7.72 >>> sec_struc = X.secondary_structure_fraction() # [helix, turn, sheet] >>> print("%0.2f" % sec_struc[0]) # helix 0.28 >>> epsilon_prot = X.molar_extinction_coefficient() # [reduced, oxidized] >>> print(epsilon_prot[0]) # with reduced cysteines 17420 >>> print(epsilon_prot[1]) # with disulfid bridges 17545 Other public methods are: - gravy - protein_scale - flexibility """ from __future__ import print_function import sys from Bio.SeqUtils import ProtParamData # Local from Bio.SeqUtils import IsoelectricPoint # Local from Bio.Seq import Seq from Bio.Alphabet import IUPAC from Bio.Data import IUPACData from Bio.SeqUtils import molecular_weight class ProteinAnalysis(object): """Class containing methods for protein analysis. The constructor takes two arguments. The first is the protein sequence as a string, which is then converted to a sequence object using the Bio.Seq module. This is done just to make sure the sequence is a protein sequence and not anything else. The second argument is optional. If set to True, the weight of the amino acids will be calculated using their monoisotopic mass (the weight of the most abundant isotopes for each element), instead of the average molecular mass (the averaged weight of all stable isotopes for each element). If set to false (the default value) or left out, the IUPAC average molecular mass will be used for the calculation. """ def __init__(self, prot_sequence, monoisotopic=False): """Initialize the class.""" if prot_sequence.islower(): self.sequence = Seq(prot_sequence.upper(), IUPAC.protein) else: self.sequence = Seq(prot_sequence, IUPAC.protein) self.amino_acids_content = None self.amino_acids_percent = None self.length = len(self.sequence) self.monoisotopic = monoisotopic def count_amino_acids(self): """Count standard amino acids, return a dict. Counts the number times each amino acid is in the protein sequence. Returns a dictionary {AminoAcid:Number}. The return value is cached in self.amino_acids_content. It is not recalculated upon subsequent calls. """ if self.amino_acids_content is None: prot_dic = dict((k, 0) for k in IUPACData.protein_letters) for aa in prot_dic: prot_dic[aa] = self.sequence.count(aa) self.amino_acids_content = prot_dic return self.amino_acids_content def get_amino_acids_percent(self): """Calculate the amino acid content in percentages. The same as count_amino_acids only returns the Number in percentage of entire sequence. Returns a dictionary of {AminoAcid:percentage}. The return value is cached in self.amino_acids_percent. input is the dictionary self.amino_acids_content. output is a dictionary with amino acids as keys. """ if self.amino_acids_percent is None: aa_counts = self.count_amino_acids() percentages = {} for aa in aa_counts: percentages[aa] = aa_counts[aa] / float(self.length) self.amino_acids_percent = percentages return self.amino_acids_percent def molecular_weight(self): """Calculate MW from Protein sequence.""" return molecular_weight(self.sequence, monoisotopic=self.monoisotopic) def aromaticity(self): """Calculate the aromaticity according to Lobry, 1994. Calculates the aromaticity value of a protein according to Lobry, 1994. It is simply the relative frequency of Phe+Trp+Tyr. """ aromatic_aas = 'YWF' aa_percentages = self.get_amino_acids_percent() aromaticity = sum(aa_percentages[aa] for aa in aromatic_aas) return aromaticity def instability_index(self): """Calculate the instability index according to Guruprasad et al 1990. Implementation of the method of Guruprasad et al. 1990 to test a protein for stability. Any value above 40 means the protein is unstable (has a short half life). See: Guruprasad K., Reddy B.V.B., Pandit M.W. Protein Engineering 4:155-161(1990). """ index = ProtParamData.DIWV score = 0.0 for i in range(self.length - 1): this, next = self.sequence[i:i + 2] dipeptide_value = index[this][next] score += dipeptide_value return (10.0 / self.length) * score def flexibility(self): """Calculate the flexibility according to Vihinen, 1994. No argument to change window size because parameters are specific for a window=9. The parameters used are optimized for determining the flexibility. """ flexibilities = ProtParamData.Flex window_size = 9 weights = [0.25, 0.4375, 0.625, 0.8125, 1] scores = [] for i in range(self.length - window_size): subsequence = self.sequence[i:i + window_size] score = 0.0 for j in range(window_size // 2): front = subsequence[j] back = subsequence[window_size - j - 1] score += (flexibilities[front] + flexibilities[back]) * weights[j] middle = subsequence[window_size // 2 + 1] score += flexibilities[middle] scores.append(score / 5.25) return scores def gravy(self): """Calculate the gravy according to Kyte and Doolittle.""" total_gravy = sum(ProtParamData.kd[aa] for aa in self.sequence) return total_gravy / self.length def _weight_list(self, window, edge): """Make list of relative weight of window edges (PRIVATE). The relative weight of window edges are compared to the window center. The weights are linear. It actually generates half a list. For a window of size 9 and edge 0.4 you get a list of [0.4, 0.55, 0.7, 0.85]. """ unit = 2 * (1.0 - edge) / (window - 1) weights = [0.0] * (window // 2) for i in range(window // 2): weights[i] = edge + unit * i return weights def protein_scale(self, param_dict, window, edge=1.0): """Compute a profile by any amino acid scale. An amino acid scale is defined by a numerical value assigned to each type of amino acid. The most frequently used scales are the hydrophobicity or hydrophilicity scales and the secondary structure conformational parameters scales, but many other scales exist which are based on different chemical and physical properties of the amino acids. You can set several parameters that control the computation of a scale profile, such as the window size and the window edge relative weight value. WindowSize: The window size is the length of the interval to use for the profile computation. For a window size n, we use the i-(n-1)/2 neighboring residues on each side to compute the score for residue i. The score for residue i is the sum of the scaled values for these amino acids, optionally weighted according to their position in the window. Edge: The central amino acid of the window always has a weight of 1. By default, the amino acids at the remaining window positions have the same weight, but you can make the residue at the center of the window have a larger weight than the others by setting the edge value for the residues at the beginning and end of the interval to a value between 0 and 1. For instance, for Edge=0.4 and a window size of 5 the weights will be: 0.4, 0.7, 1.0, 0.7, 0.4. The method returns a list of values which can be plotted to view the change along a protein sequence. Many scales exist. Just add your favorites to the ProtParamData modules. Similar to expasy's ProtScale: http://www.expasy.org/cgi-bin/protscale.pl """ # generate the weights # _weight_list returns only one tail. If the list should be # [0.4,0.7,1.0,0.7,0.4] what you actually get from _weights_list # is [0.4,0.7]. The correct calculation is done in the loop. weights = self._weight_list(window, edge) scores = [] # the score in each Window is divided by the sum of weights # (* 2 + 1) since the weight list is one sided: sum_of_weights = sum(weights) * 2 + 1 for i in range(self.length - window + 1): subsequence = self.sequence[i:i + window] score = 0.0 for j in range(window // 2): # walk from the outside of the Window towards the middle. # Iddo: try/except clauses added to avoid raising an exception # on a non-standard amino acid try: front = param_dict[subsequence[j]] back = param_dict[subsequence[window - j - 1]] score += weights[j] * front + weights[j] * back except KeyError: sys.stderr.write('warning: %s or %s is not a standard ' 'amino acid.\n' % (subsequence[j], subsequence[window - j - 1])) # Now add the middle value, which always has a weight of 1. middle = subsequence[window // 2] if middle in param_dict: score += param_dict[middle] else: sys.stderr.write('warning: %s is not a standard amino acid.\n' % middle) scores.append(score / sum_of_weights) return scores def isoelectric_point(self): """Calculate the isoelectric point. Uses the module IsoelectricPoint to calculate the pI of a protein. """ aa_content = self.count_amino_acids() ie_point = IsoelectricPoint.IsoelectricPoint(self.sequence, aa_content) return ie_point.pi() def secondary_structure_fraction(self): """Calculate fraction of helix, turn and sheet. Returns a list of the fraction of amino acids which tend to be in Helix, Turn or Sheet. Amino acids in helix: V, I, Y, F, W, L. Amino acids in Turn: N, P, G, S. Amino acids in sheet: E, M, A, L. Returns a tuple of three floats (Helix, Turn, Sheet). """ aa_percentages = self.get_amino_acids_percent() helix = sum(aa_percentages[r] for r in 'VIYFWL') turn = sum(aa_percentages[r] for r in 'NPGS') sheet = sum(aa_percentages[r] for r in 'EMAL') return helix, turn, sheet def molar_extinction_coefficient(self): """Calculate the molar extinction coefficient. Calculates the molar extinction coefficient assuming cysteines (reduced) and cystines residues (Cys-Cys-bond) """ num_aa = self.count_amino_acids() mec_reduced = num_aa['W'] * 5500 + num_aa['Y'] * 1490 mec_cystines = mec_reduced + (num_aa['C'] // 2) * 125 return(mec_reduced, mec_cystines) if __name__ == "__main__": from Bio._utils import run_doctest run_doctest()