# Copyright 2000 Andrew Dalke. # Copyright 2000-2002 Brad Chapman. # Copyright 2004-2005, 2010 by M de Hoon. # Copyright 2007-2018 by Peter Cock. # All rights reserved. # # This file is part of the Biopython distribution and governed by your # choice of the "Biopython License Agreement" or the "BSD 3-Clause License". # Please see the LICENSE file that should have been included as part of this # package. """Provide objects to represent biological sequences with alphabets. See also the Seq_ wiki and the chapter in our tutorial: - `HTML Tutorial`_ - `PDF Tutorial`_ .. _Seq: http://biopython.org/wiki/Seq .. _`HTML Tutorial`: http://biopython.org/DIST/docs/tutorial/Tutorial.html .. _`PDF Tutorial`: http://biopython.org/DIST/docs/tutorial/Tutorial.pdf """ from __future__ import print_function import string # for maketrans only import array import sys import warnings from Bio._py3k import range from Bio._py3k import basestring from Bio import BiopythonWarning from Bio import Alphabet from Bio.Alphabet import IUPAC from Bio.Data.IUPACData import (ambiguous_dna_complement, ambiguous_rna_complement) from Bio.Data.IUPACData import ambiguous_dna_letters as _ambiguous_dna_letters from Bio.Data.IUPACData import ambiguous_rna_letters as _ambiguous_rna_letters from Bio.Data import CodonTable def _maketrans(complement_mapping): """Make a python string translation table (PRIVATE). Arguments: - complement_mapping - a dictionary such as ambiguous_dna_complement and ambiguous_rna_complement from Data.IUPACData. Returns a translation table (a string of length 256) for use with the python string's translate method to use in a (reverse) complement. Compatible with lower case and upper case sequences. For internal use only. """ before = ''.join(complement_mapping.keys()) after = ''.join(complement_mapping.values()) before += before.lower() after += after.lower() if sys.version_info[0] == 3: return str.maketrans(before, after) else: return string.maketrans(before, after) _dna_complement_table = _maketrans(ambiguous_dna_complement) _rna_complement_table = _maketrans(ambiguous_rna_complement) class Seq(object): """Read-only sequence object (essentially a string with an alphabet). Like normal python strings, our basic sequence object is immutable. This prevents you from doing my_seq[5] = "A" for example, but does allow Seq objects to be used as dictionary keys. The Seq object provides a number of string like methods (such as count, find, split and strip), which are alphabet aware where appropriate. In addition to the string like sequence, the Seq object has an alphabet property. This is an instance of an Alphabet class from Bio.Alphabet, for example generic DNA, or IUPAC DNA. This describes the type of molecule (e.g. RNA, DNA, protein) and may also indicate the expected symbols (letters). The Seq object also provides some biological methods, such as complement, reverse_complement, transcribe, back_transcribe and translate (which are not applicable to sequences with a protein alphabet). """ def __init__(self, data, alphabet=Alphabet.generic_alphabet): """Create a Seq object. Arguments: - seq - Sequence, required (string) - alphabet - Optional argument, an Alphabet object from Bio.Alphabet You will typically use Bio.SeqIO to read in sequences from files as SeqRecord objects, whose sequence will be exposed as a Seq object via the seq property. However, will often want to create your own Seq objects directly: >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> my_seq = Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF", ... IUPAC.protein) >>> my_seq Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF', IUPACProtein()) >>> print(my_seq) MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF >>> my_seq.alphabet IUPACProtein() """ # Enforce string storage if not isinstance(data, basestring): raise TypeError("The sequence data given to a Seq object should " "be a string (not another Seq object etc)") self._data = data self.alphabet = alphabet # Seq API requirement def __repr__(self): """Return (truncated) representation of the sequence for debugging.""" if self.alphabet is Alphabet.generic_alphabet: # Default used, we can omit it and simplify the representation a = "" else: a = ", %r" % self.alphabet if len(self) > 60: # Shows the last three letters as it is often useful to see if # there is a stop codon at the end of a sequence. # Note total length is 54+3+3=60 return "{0}('{1}...{2}'{3!s})".format(self.__class__.__name__, str(self)[:54], str(self)[-3:], a) else: return '{0}({1!r}{2!s})'.format(self.__class__.__name__, self._data, a) def __str__(self): """Return the full sequence as a python string, use str(my_seq). Note that Biopython 1.44 and earlier would give a truncated version of repr(my_seq) for str(my_seq). If you are writing code which need to be backwards compatible with old Biopython, you should continue to use my_seq.tostring() rather than str(my_seq). """ return self._data def __hash__(self): """Hash for comparison. See the __cmp__ documentation - this has changed from past versions of Biopython! """ # TODO - remove this warning in a future release warnings.warn("Biopython Seq objects now use string comparison. " "Older versions of Biopython used object comparison. " "During this transition, please use hash(id(my_seq)) " "or my_dict[id(my_seq)] if you want the old behaviour, " "or use hash(str(my_seq)) or my_dict[str(my_seq)] for " "the new string hashing behaviour.", BiopythonWarning) return hash(str(self)) def __eq__(self, other): """Compare the sequence to another sequence or a string (README). Historically comparing Seq objects has done Python object comparison. After considerable discussion (keeping in mind constraints of the Python language, hashes and dictionary support), Biopython now uses simple string comparison (with a warning about the change). Note that incompatible alphabets (e.g. DNA to RNA) will trigger a warning. During this transition period, please just do explicit comparisons: >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_dna >>> seq1 = Seq("ACGT") >>> seq2 = Seq("ACGT") >>> id(seq1) == id(seq2) False >>> str(seq1) == str(seq2) True The new behaviour is to use string-like equality: >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_dna >>> seq1 == seq2 True >>> seq1 == "ACGT" True >>> seq1 == Seq("ACGT", generic_dna) True """ if hasattr(other, "alphabet"): # other could be a Seq or a MutableSeq if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): warnings.warn("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet), BiopythonWarning) return str(self) == str(other) def __ne__(self, other): """Implement the not-equal operand.""" # Require this method for Python 2 but not needed on Python 3 return not self == other def __lt__(self, other): """Implement the less-than operand.""" if hasattr(other, "alphabet"): if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): warnings.warn("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet), BiopythonWarning) if isinstance(other, (str, Seq, MutableSeq, UnknownSeq)): return str(self) < str(other) raise TypeError("'<' not supported between instances of '{}' and '{}'" .format(type(self).__name__, type(other).__name__)) def __le__(self, other): """Implement the less-than or equal operand.""" if hasattr(other, "alphabet"): if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): warnings.warn("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet), BiopythonWarning) if isinstance(other, (str, Seq, MutableSeq, UnknownSeq)): return str(self) <= str(other) raise TypeError("'<=' not supported between instances of '{}' and '{}'" .format(type(self).__name__, type(other).__name__)) def __gt__(self, other): """Implement the greater-than operand.""" if hasattr(other, "alphabet"): if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): warnings.warn("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet), BiopythonWarning) if isinstance(other, (str, Seq, MutableSeq, UnknownSeq)): return str(self) > str(other) raise TypeError("'>' not supported between instances of '{}' and '{}'" .format(type(self).__name__, type(other).__name__)) def __ge__(self, other): """Implement the greater-than or equal operand.""" if hasattr(other, "alphabet"): if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): warnings.warn("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet), BiopythonWarning) if isinstance(other, (str, Seq, MutableSeq, UnknownSeq)): return str(self) >= str(other) raise TypeError("'>=' not supported between instances of '{}' and '{}'" .format(type(self).__name__, type(other).__name__)) def __len__(self): """Return the length of the sequence, use len(my_seq).""" return len(self._data) # Seq API requirement def __getitem__(self, index): # Seq API requirement """Return a subsequence of single letter, use my_seq[index]. >>> my_seq = Seq('ACTCGACGTCG') >>> my_seq[5] 'A' """ # Note since Python 2.0, __getslice__ is deprecated # and __getitem__ is used instead. # See http://docs.python.org/ref/sequence-methods.html if isinstance(index, int): # Return a single letter as a string return self._data[index] else: # Return the (sub)sequence as another Seq object return Seq(self._data[index], self.alphabet) def __add__(self, other): """Add another sequence or string to this sequence. If adding a string to a Seq, the alphabet is preserved: >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_protein >>> Seq("MELKI", generic_protein) + "LV" Seq('MELKILV', ProteinAlphabet()) When adding two Seq (like) objects, the alphabets are important. Consider this example: >>> from Bio.Seq import Seq >>> from Bio.Alphabet.IUPAC import unambiguous_dna, ambiguous_dna >>> unamb_dna_seq = Seq("ACGT", unambiguous_dna) >>> ambig_dna_seq = Seq("ACRGT", ambiguous_dna) >>> unamb_dna_seq Seq('ACGT', IUPACUnambiguousDNA()) >>> ambig_dna_seq Seq('ACRGT', IUPACAmbiguousDNA()) If we add the ambiguous and unambiguous IUPAC DNA alphabets, we get the more general ambiguous IUPAC DNA alphabet: >>> unamb_dna_seq + ambig_dna_seq Seq('ACGTACRGT', IUPACAmbiguousDNA()) However, if the default generic alphabet is included, the result is a generic alphabet: >>> Seq("") + ambig_dna_seq Seq('ACRGT') You can't add RNA and DNA sequences: >>> from Bio.Alphabet import generic_dna, generic_rna >>> Seq("ACGT", generic_dna) + Seq("ACGU", generic_rna) Traceback (most recent call last): ... TypeError: Incompatible alphabets DNAAlphabet() and RNAAlphabet() You can't add nucleotide and protein sequences: >>> from Bio.Alphabet import generic_dna, generic_protein >>> Seq("ACGT", generic_dna) + Seq("MELKI", generic_protein) Traceback (most recent call last): ... TypeError: Incompatible alphabets DNAAlphabet() and ProteinAlphabet() """ if hasattr(other, "alphabet"): # other should be a Seq or a MutableSeq if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): raise TypeError( "Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet)) # They should be the same sequence type (or one of them is generic) a = Alphabet._consensus_alphabet([self.alphabet, other.alphabet]) return self.__class__(str(self) + str(other), a) elif isinstance(other, basestring): # other is a plain string - use the current alphabet return self.__class__(str(self) + other, self.alphabet) from Bio.SeqRecord import SeqRecord # Lazy to avoid circular imports if isinstance(other, SeqRecord): # Get the SeqRecord's __radd__ to handle this return NotImplemented else: raise TypeError def __radd__(self, other): """Add a sequence on the left. If adding a string to a Seq, the alphabet is preserved: >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_protein >>> "LV" + Seq("MELKI", generic_protein) Seq('LVMELKI', ProteinAlphabet()) Adding two Seq (like) objects is handled via the __add__ method. """ if hasattr(other, "alphabet"): # other should be a Seq or a MutableSeq if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): raise TypeError( "Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet)) # They should be the same sequence type (or one of them is generic) a = Alphabet._consensus_alphabet([self.alphabet, other.alphabet]) return self.__class__(str(other) + str(self), a) elif isinstance(other, basestring): # other is a plain string - use the current alphabet return self.__class__(other + str(self), self.alphabet) else: raise TypeError def __mul__(self, other): """Multiply Seq by integer. >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_dna >>> Seq('ATG') * 2 Seq('ATGATG') >>> Seq('ATG', generic_dna) * 2 Seq('ATGATG', DNAAlphabet()) """ if not isinstance(other, int): raise TypeError("can't multiply {} by non-int type".format(self.__class__.__name__)) return self.__class__(str(self) * other, self.alphabet) def __rmul__(self, other): """Multiply integer by Seq. >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_dna >>> 2 * Seq('ATG') Seq('ATGATG') >>> 2 * Seq('ATG', generic_dna) Seq('ATGATG', DNAAlphabet()) """ if not isinstance(other, int): raise TypeError("can't multiply {} by non-int type".format(self.__class__.__name__)) return self.__class__(str(self) * other, self.alphabet) def __imul__(self, other): """Multiply Seq in-place. Note although Seq is immutable, the in-place method is included to match the behaviour for regular Python strings. >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_dna >>> seq = Seq('ATG', generic_dna) >>> seq *= 2 >>> seq Seq('ATGATG', DNAAlphabet()) """ if not isinstance(other, int): raise TypeError("can't multiply {} by non-int type".format(self.__class__.__name__)) return self.__class__(str(self) * other, self.alphabet) def tomutable(self): # Needed? Or use a function? """Return the full sequence as a MutableSeq object. >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> my_seq = Seq("MKQHKAMIVALIVICITAVVAAL", ... IUPAC.protein) >>> my_seq Seq('MKQHKAMIVALIVICITAVVAAL', IUPACProtein()) >>> my_seq.tomutable() MutableSeq('MKQHKAMIVALIVICITAVVAAL', IUPACProtein()) Note that the alphabet is preserved. """ return MutableSeq(str(self), self.alphabet) def _get_seq_str_and_check_alphabet(self, other_sequence): """Convert string/Seq/MutableSeq to string, checking alphabet (PRIVATE). For a string argument, returns the string. For a Seq or MutableSeq, it checks the alphabet is compatible (raising an exception if it isn't), and then returns a string. """ try: other_alpha = other_sequence.alphabet except AttributeError: # Assume other_sequence is a string return other_sequence # Other should be a Seq or a MutableSeq if not Alphabet._check_type_compatible([self.alphabet, other_alpha]): raise TypeError("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other_alpha)) # Return as a string return str(other_sequence) def count(self, sub, start=0, end=sys.maxsize): """Return a non-overlapping count, like that of a python string. This behaves like the python string method of the same name, which does a non-overlapping count! For an overlapping search use the newer count_overlap() method. Returns an integer, the number of occurrences of substring argument sub in the (sub)sequence given by [start:end]. Optional arguments start and end are interpreted as in slice notation. Arguments: - sub - a string or another Seq object to look for - start - optional integer, slice start - end - optional integer, slice end e.g. >>> from Bio.Seq import Seq >>> my_seq = Seq("AAAATGA") >>> print(my_seq.count("A")) 5 >>> print(my_seq.count("ATG")) 1 >>> print(my_seq.count(Seq("AT"))) 1 >>> print(my_seq.count("AT", 2, -1)) 1 HOWEVER, please note because python strings and Seq objects (and MutableSeq objects) do a non-overlapping search, this may not give the answer you expect: >>> "AAAA".count("AA") 2 >>> print(Seq("AAAA").count("AA")) 2 An overlapping search, as implemented in .count_overlap(), would give the answer as three! """ # If it has one, check the alphabet: sub_str = self._get_seq_str_and_check_alphabet(sub) return str(self).count(sub_str, start, end) def count_overlap(self, sub, start=0, end=sys.maxsize): """Return an overlapping count. For a non-overlapping search use the count() method. Returns an integer, the number of occurrences of substring argument sub in the (sub)sequence given by [start:end]. Optional arguments start and end are interpreted as in slice notation. Arguments: - sub - a string or another Seq object to look for - start - optional integer, slice start - end - optional integer, slice end e.g. >>> from Bio.Seq import Seq >>> print(Seq("AAAA").count_overlap("AA")) 3 >>> print(Seq("ATATATATA").count_overlap("ATA")) 4 >>> print(Seq("ATATATATA").count_overlap("ATA", 3, -1)) 1 Where substrings do not overlap, should behave the same as the count() method: >>> from Bio.Seq import Seq >>> my_seq = Seq("AAAATGA") >>> print(my_seq.count_overlap("A")) 5 >>> my_seq.count_overlap("A") == my_seq.count("A") True >>> print(my_seq.count_overlap("ATG")) 1 >>> my_seq.count_overlap("ATG") == my_seq.count("ATG") True >>> print(my_seq.count_overlap(Seq("AT"))) 1 >>> my_seq.count_overlap(Seq("AT")) == my_seq.count(Seq("AT")) True >>> print(my_seq.count_overlap("AT", 2, -1)) 1 >>> my_seq.count_overlap("AT", 2, -1) == my_seq.count("AT", 2, -1) True HOWEVER, do not use this method for such cases because the count() method is much for efficient. """ sub_str = self._get_seq_str_and_check_alphabet(sub) self_str = str(self) overlap_count = 0 while True: start = self_str.find(sub_str, start, end) + 1 if start != 0: overlap_count += 1 else: return overlap_count def __contains__(self, char): """Implement the 'in' keyword, like a python string. e.g. >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_dna, generic_rna, generic_protein >>> my_dna = Seq("ATATGAAATTTGAAAA", generic_dna) >>> "AAA" in my_dna True >>> Seq("AAA") in my_dna True >>> Seq("AAA", generic_dna) in my_dna True Like other Seq methods, this will raise a type error if another Seq (or Seq like) object with an incompatible alphabet is used: >>> Seq("AAA", generic_rna) in my_dna Traceback (most recent call last): ... TypeError: Incompatible alphabets DNAAlphabet() and RNAAlphabet() >>> Seq("AAA", generic_protein) in my_dna Traceback (most recent call last): ... TypeError: Incompatible alphabets DNAAlphabet() and ProteinAlphabet() """ # If it has one, check the alphabet: sub_str = self._get_seq_str_and_check_alphabet(char) return sub_str in str(self) def find(self, sub, start=0, end=sys.maxsize): """Find method, like that of a python string. This behaves like the python string method of the same name. Returns an integer, the index of the first occurrence of substring argument sub in the (sub)sequence given by [start:end]. Arguments: - sub - a string or another Seq object to look for - start - optional integer, slice start - end - optional integer, slice end Returns -1 if the subsequence is NOT found. e.g. Locating the first typical start codon, AUG, in an RNA sequence: >>> from Bio.Seq import Seq >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") >>> my_rna.find("AUG") 3 """ # If it has one, check the alphabet: sub_str = self._get_seq_str_and_check_alphabet(sub) return str(self).find(sub_str, start, end) def rfind(self, sub, start=0, end=sys.maxsize): """Find from right method, like that of a python string. This behaves like the python string method of the same name. Returns an integer, the index of the last (right most) occurrence of substring argument sub in the (sub)sequence given by [start:end]. Arguments: - sub - a string or another Seq object to look for - start - optional integer, slice start - end - optional integer, slice end Returns -1 if the subsequence is NOT found. e.g. Locating the last typical start codon, AUG, in an RNA sequence: >>> from Bio.Seq import Seq >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") >>> my_rna.rfind("AUG") 15 """ # If it has one, check the alphabet: sub_str = self._get_seq_str_and_check_alphabet(sub) return str(self).rfind(sub_str, start, end) def startswith(self, prefix, start=0, end=sys.maxsize): """Return True if the Seq starts with the given prefix, False otherwise. This behaves like the python string method of the same name. Return True if the sequence starts with the specified prefix (a string or another Seq object), False otherwise. With optional start, test sequence beginning at that position. With optional end, stop comparing sequence at that position. prefix can also be a tuple of strings to try. e.g. >>> from Bio.Seq import Seq >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") >>> my_rna.startswith("GUC") True >>> my_rna.startswith("AUG") False >>> my_rna.startswith("AUG", 3) True >>> my_rna.startswith(("UCC", "UCA", "UCG"), 1) True """ # If it has one, check the alphabet: if isinstance(prefix, tuple): prefix_strs = tuple(self._get_seq_str_and_check_alphabet(p) for p in prefix) return str(self).startswith(prefix_strs, start, end) else: prefix_str = self._get_seq_str_and_check_alphabet(prefix) return str(self).startswith(prefix_str, start, end) def endswith(self, suffix, start=0, end=sys.maxsize): """Return True if the Seq ends with the given suffix, False otherwise. This behaves like the python string method of the same name. Return True if the sequence ends with the specified suffix (a string or another Seq object), False otherwise. With optional start, test sequence beginning at that position. With optional end, stop comparing sequence at that position. suffix can also be a tuple of strings to try. e.g. >>> from Bio.Seq import Seq >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") >>> my_rna.endswith("UUG") True >>> my_rna.endswith("AUG") False >>> my_rna.endswith("AUG", 0, 18) True >>> my_rna.endswith(("UCC", "UCA", "UUG")) True """ # If it has one, check the alphabet: if isinstance(suffix, tuple): suffix_strs = tuple(self._get_seq_str_and_check_alphabet(p) for p in suffix) return str(self).endswith(suffix_strs, start, end) else: suffix_str = self._get_seq_str_and_check_alphabet(suffix) return str(self).endswith(suffix_str, start, end) def split(self, sep=None, maxsplit=-1): """Split method, like that of a python string. This behaves like the python string method of the same name. Return a list of the 'words' in the string (as Seq objects), using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done. If maxsplit is omitted, all splits are made. Following the python string method, sep will by default be any white space (tabs, spaces, newlines) but this is unlikely to apply to biological sequences. e.g. >>> from Bio.Seq import Seq >>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG") >>> my_aa = my_rna.translate() >>> my_aa Seq('VMAIVMGR*KGAR*L', HasStopCodon(ExtendedIUPACProtein(), '*')) >>> for pep in my_aa.split("*"): ... pep Seq('VMAIVMGR', HasStopCodon(ExtendedIUPACProtein(), '*')) Seq('KGAR', HasStopCodon(ExtendedIUPACProtein(), '*')) Seq('L', HasStopCodon(ExtendedIUPACProtein(), '*')) >>> for pep in my_aa.split("*", 1): ... pep Seq('VMAIVMGR', HasStopCodon(ExtendedIUPACProtein(), '*')) Seq('KGAR*L', HasStopCodon(ExtendedIUPACProtein(), '*')) See also the rsplit method: >>> for pep in my_aa.rsplit("*", 1): ... pep Seq('VMAIVMGR*KGAR', HasStopCodon(ExtendedIUPACProtein(), '*')) Seq('L', HasStopCodon(ExtendedIUPACProtein(), '*')) """ # If it has one, check the alphabet: sep_str = self._get_seq_str_and_check_alphabet(sep) # TODO - If the sep is the defined stop symbol, or gap char, # should we adjust the alphabet? return [Seq(part, self.alphabet) for part in str(self).split(sep_str, maxsplit)] def rsplit(self, sep=None, maxsplit=-1): """Do a right split method, like that of a python string. This behaves like the python string method of the same name. Return a list of the 'words' in the string (as Seq objects), using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done COUNTING FROM THE RIGHT. If maxsplit is omitted, all splits are made. Following the python string method, sep will by default be any white space (tabs, spaces, newlines) but this is unlikely to apply to biological sequences. e.g. print(my_seq.rsplit("*",1)) See also the split method. """ # If it has one, check the alphabet: sep_str = self._get_seq_str_and_check_alphabet(sep) return [Seq(part, self.alphabet) for part in str(self).rsplit(sep_str, maxsplit)] def strip(self, chars=None): """Return a new Seq object with leading and trailing ends stripped. This behaves like the python string method of the same name. Optional argument chars defines which characters to remove. If omitted or None (default) then as for the python string method, this defaults to removing any white space. e.g. print(my_seq.strip("-")) See also the lstrip and rstrip methods. """ # If it has one, check the alphabet: strip_str = self._get_seq_str_and_check_alphabet(chars) return Seq(str(self).strip(strip_str), self.alphabet) def lstrip(self, chars=None): """Return a new Seq object with leading (left) end stripped. This behaves like the python string method of the same name. Optional argument chars defines which characters to remove. If omitted or None (default) then as for the python string method, this defaults to removing any white space. e.g. print(my_seq.lstrip("-")) See also the strip and rstrip methods. """ # If it has one, check the alphabet: strip_str = self._get_seq_str_and_check_alphabet(chars) return Seq(str(self).lstrip(strip_str), self.alphabet) def rstrip(self, chars=None): """Return a new Seq object with trailing (right) end stripped. This behaves like the python string method of the same name. Optional argument chars defines which characters to remove. If omitted or None (default) then as for the python string method, this defaults to removing any white space. e.g. Removing a nucleotide sequence's polyadenylation (poly-A tail): >>> from Bio.Alphabet import IUPAC >>> from Bio.Seq import Seq >>> my_seq = Seq("CGGTACGCTTATGTCACGTAGAAAAAA", IUPAC.unambiguous_dna) >>> my_seq Seq('CGGTACGCTTATGTCACGTAGAAAAAA', IUPACUnambiguousDNA()) >>> my_seq.rstrip("A") Seq('CGGTACGCTTATGTCACGTAG', IUPACUnambiguousDNA()) See also the strip and lstrip methods. """ # If it has one, check the alphabet: strip_str = self._get_seq_str_and_check_alphabet(chars) return Seq(str(self).rstrip(strip_str), self.alphabet) def upper(self): """Return an upper case copy of the sequence. >>> from Bio.Alphabet import HasStopCodon, generic_protein >>> from Bio.Seq import Seq >>> my_seq = Seq("VHLTPeeK*", HasStopCodon(generic_protein)) >>> my_seq Seq('VHLTPeeK*', HasStopCodon(ProteinAlphabet(), '*')) >>> my_seq.lower() Seq('vhltpeek*', HasStopCodon(ProteinAlphabet(), '*')) >>> my_seq.upper() Seq('VHLTPEEK*', HasStopCodon(ProteinAlphabet(), '*')) This will adjust the alphabet if required. See also the lower method. """ return Seq(str(self).upper(), self.alphabet._upper()) def lower(self): """Return a lower case copy of the sequence. This will adjust the alphabet if required. Note that the IUPAC alphabets are upper case only, and thus a generic alphabet must be substituted. >>> from Bio.Alphabet import Gapped, generic_dna >>> from Bio.Alphabet import IUPAC >>> from Bio.Seq import Seq >>> my_seq = Seq("CGGTACGCTTATGTCACGTAG*AAAAAA", ... Gapped(IUPAC.unambiguous_dna, "*")) >>> my_seq Seq('CGGTACGCTTATGTCACGTAG*AAAAAA', Gapped(IUPACUnambiguousDNA(), '*')) >>> my_seq.lower() Seq('cggtacgcttatgtcacgtag*aaaaaa', Gapped(DNAAlphabet(), '*')) See also the upper method. """ return Seq(str(self).lower(), self.alphabet._lower()) def complement(self): """Return the complement sequence by creating a new Seq object. >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> my_dna = Seq("CCCCCGATAG", IUPAC.unambiguous_dna) >>> my_dna Seq('CCCCCGATAG', IUPACUnambiguousDNA()) >>> my_dna.complement() Seq('GGGGGCTATC', IUPACUnambiguousDNA()) You can of course used mixed case sequences, >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_dna >>> my_dna = Seq("CCCCCgatA-GD", generic_dna) >>> my_dna Seq('CCCCCgatA-GD', DNAAlphabet()) >>> my_dna.complement() Seq('GGGGGctaT-CH', DNAAlphabet()) Note in the above example, ambiguous character D denotes G, A or T so its complement is H (for C, T or A). Trying to complement a protein sequence raises an exception. >>> my_protein = Seq("MAIVMGR", IUPAC.protein) >>> my_protein.complement() Traceback (most recent call last): ... ValueError: Proteins do not have complements! """ base = Alphabet._get_base_alphabet(self.alphabet) if isinstance(base, Alphabet.ProteinAlphabet): raise ValueError("Proteins do not have complements!") if isinstance(base, Alphabet.DNAAlphabet): ttable = _dna_complement_table elif isinstance(base, Alphabet.RNAAlphabet): ttable = _rna_complement_table elif ('U' in self._data or 'u' in self._data) \ and ('T' in self._data or 't' in self._data): # TODO - Handle this cleanly? raise ValueError("Mixed RNA/DNA found") elif 'U' in self._data or 'u' in self._data: ttable = _rna_complement_table else: ttable = _dna_complement_table # Much faster on really long sequences than the previous loop based # one. Thanks to Michael Palmer, University of Waterloo. return Seq(str(self).translate(ttable), self.alphabet) def reverse_complement(self): """Return the reverse complement sequence by creating a new Seq object. >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> my_dna = Seq("CCCCCGATAGNR", IUPAC.ambiguous_dna) >>> my_dna Seq('CCCCCGATAGNR', IUPACAmbiguousDNA()) >>> my_dna.reverse_complement() Seq('YNCTATCGGGGG', IUPACAmbiguousDNA()) Note in the above example, since R = G or A, its complement is Y (which denotes C or T). You can of course used mixed case sequences, >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_dna >>> my_dna = Seq("CCCCCgatA-G", generic_dna) >>> my_dna Seq('CCCCCgatA-G', DNAAlphabet()) >>> my_dna.reverse_complement() Seq('C-TatcGGGGG', DNAAlphabet()) Trying to complement a protein sequence raises an exception: >>> my_protein = Seq("MAIVMGR", IUPAC.protein) >>> my_protein.reverse_complement() Traceback (most recent call last): ... ValueError: Proteins do not have complements! """ # Use -1 stride/step to reverse the complement return self.complement()[::-1] def transcribe(self): """Return the RNA sequence from a DNA sequence by creating a new Seq object. >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> coding_dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG", ... IUPAC.unambiguous_dna) >>> coding_dna Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG', IUPACUnambiguousDNA()) >>> coding_dna.transcribe() Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG', IUPACUnambiguousRNA()) Trying to transcribe a protein or RNA sequence raises an exception: >>> my_protein = Seq("MAIVMGR", IUPAC.protein) >>> my_protein.transcribe() Traceback (most recent call last): ... ValueError: Proteins cannot be transcribed! """ base = Alphabet._get_base_alphabet(self.alphabet) if isinstance(base, Alphabet.ProteinAlphabet): raise ValueError("Proteins cannot be transcribed!") if isinstance(base, Alphabet.RNAAlphabet): raise ValueError("RNA cannot be transcribed!") if self.alphabet == IUPAC.unambiguous_dna: alphabet = IUPAC.unambiguous_rna elif self.alphabet == IUPAC.ambiguous_dna: alphabet = IUPAC.ambiguous_rna else: alphabet = Alphabet.generic_rna return Seq(str(self).replace('T', 'U').replace('t', 'u'), alphabet) def back_transcribe(self): """Return the DNA sequence from an RNA sequence by creating a new Seq object. >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> messenger_rna = Seq("AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG", ... IUPAC.unambiguous_rna) >>> messenger_rna Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG', IUPACUnambiguousRNA()) >>> messenger_rna.back_transcribe() Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG', IUPACUnambiguousDNA()) Trying to back-transcribe a protein or DNA sequence raises an exception: >>> my_protein = Seq("MAIVMGR", IUPAC.protein) >>> my_protein.back_transcribe() Traceback (most recent call last): ... ValueError: Proteins cannot be back transcribed! """ base = Alphabet._get_base_alphabet(self.alphabet) if isinstance(base, Alphabet.ProteinAlphabet): raise ValueError("Proteins cannot be back transcribed!") if isinstance(base, Alphabet.DNAAlphabet): raise ValueError("DNA cannot be back transcribed!") if self.alphabet == IUPAC.unambiguous_rna: alphabet = IUPAC.unambiguous_dna elif self.alphabet == IUPAC.ambiguous_rna: alphabet = IUPAC.ambiguous_dna else: alphabet = Alphabet.generic_dna return Seq(str(self).replace("U", "T").replace("u", "t"), alphabet) def translate(self, table="Standard", stop_symbol="*", to_stop=False, cds=False, gap=None): """Turn a nucleotide sequence into a protein sequence by creating a new Seq object. This method will translate DNA or RNA sequences, and those with a nucleotide or generic alphabet. Trying to translate a protein sequence raises an exception. Arguments: - table - Which codon table to use? This can be either a name (string), an NCBI identifier (integer), or a CodonTable object (useful for non-standard genetic codes). This defaults to the "Standard" table. - stop_symbol - Single character string, what to use for terminators. This defaults to the asterisk, "*". - to_stop - Boolean, defaults to False meaning do a full translation continuing on past any stop codons (translated as the specified stop_symbol). If True, translation is terminated at the first in frame stop codon (and the stop_symbol is not appended to the returned protein sequence). - cds - Boolean, indicates this is a complete CDS. If True, this checks the sequence starts with a valid alternative start codon (which will be translated as methionine, M), that the sequence length is a multiple of three, and that there is a single in frame stop codon at the end (this will be excluded from the protein sequence, regardless of the to_stop option). If these tests fail, an exception is raised. - gap - Single character string to denote symbol used for gaps. It will try to guess the gap character from the alphabet. e.g. Using the standard table: >>> coding_dna = Seq("GTGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG") >>> coding_dna.translate() Seq('VAIVMGR*KGAR*', HasStopCodon(ExtendedIUPACProtein(), '*')) >>> coding_dna.translate(stop_symbol="@") Seq('VAIVMGR@KGAR@', HasStopCodon(ExtendedIUPACProtein(), '@')) >>> coding_dna.translate(to_stop=True) Seq('VAIVMGR', ExtendedIUPACProtein()) Now using NCBI table 2, where TGA is not a stop codon: >>> coding_dna.translate(table=2) Seq('VAIVMGRWKGAR*', HasStopCodon(ExtendedIUPACProtein(), '*')) >>> coding_dna.translate(table=2, to_stop=True) Seq('VAIVMGRWKGAR', ExtendedIUPACProtein()) In fact, GTG is an alternative start codon under NCBI table 2, meaning this sequence could be a complete CDS: >>> coding_dna.translate(table=2, cds=True) Seq('MAIVMGRWKGAR', ExtendedIUPACProtein()) It isn't a valid CDS under NCBI table 1, due to both the start codon and also the in frame stop codons: >>> coding_dna.translate(table=1, cds=True) Traceback (most recent call last): ... Bio.Data.CodonTable.TranslationError: First codon 'GTG' is not a start codon If the sequence has no in-frame stop codon, then the to_stop argument has no effect: >>> coding_dna2 = Seq("TTGGCCATTGTAATGGGCCGC") >>> coding_dna2.translate() Seq('LAIVMGR', ExtendedIUPACProtein()) >>> coding_dna2.translate(to_stop=True) Seq('LAIVMGR', ExtendedIUPACProtein()) When translating gapped sequences, the gap character is inferred from the alphabet: >>> from Bio.Alphabet import Gapped >>> coding_dna3 = Seq("GTG---GCCATT", Gapped(IUPAC.unambiguous_dna)) >>> coding_dna3.translate() Seq('V-AI', Gapped(ExtendedIUPACProtein(), '-')) It is possible to pass the gap character when the alphabet is missing: >>> coding_dna4 = Seq("GTG---GCCATT") >>> coding_dna4.translate(gap='-') Seq('V-AI', Gapped(ExtendedIUPACProtein(), '-')) NOTE - Ambiguous codons like "TAN" or "NNN" could be an amino acid or a stop codon. These are translated as "X". Any invalid codon (e.g. "TA?" or "T-A") will throw a TranslationError. NOTE - This does NOT behave like the python string's translate method. For that use str(my_seq).translate(...) instead. """ if isinstance(table, str) and len(table) == 256: raise ValueError("The Seq object translate method DOES NOT take " "a 256 character string mapping table like " "the python string object's translate method. " "Use str(my_seq).translate(...) instead.") if isinstance(Alphabet._get_base_alphabet(self.alphabet), Alphabet.ProteinAlphabet): raise ValueError("Proteins cannot be translated!") try: table_id = int(table) except ValueError: # Assume its a table name if self.alphabet == IUPAC.unambiguous_dna: # Will use standard IUPAC protein alphabet, no need for X codon_table = CodonTable.unambiguous_dna_by_name[table] elif self.alphabet == IUPAC.unambiguous_rna: # Will use standard IUPAC protein alphabet, no need for X codon_table = CodonTable.unambiguous_rna_by_name[table] else: # This will use the extended IUPAC protein alphabet with X etc. # The same table can be used for RNA or DNA (we use this for # translating strings). codon_table = CodonTable.ambiguous_generic_by_name[table] except (AttributeError, TypeError): # Assume its a CodonTable object if isinstance(table, CodonTable.CodonTable): codon_table = table else: raise ValueError('Bad table argument') else: # Assume its a table ID if self.alphabet == IUPAC.unambiguous_dna: # Will use standard IUPAC protein alphabet, no need for X codon_table = CodonTable.unambiguous_dna_by_id[table_id] elif self.alphabet == IUPAC.unambiguous_rna: # Will use standard IUPAC protein alphabet, no need for X codon_table = CodonTable.unambiguous_rna_by_id[table_id] else: # This will use the extended IUPAC protein alphabet with X etc. # The same table can be used for RNA or DNA (we use this for # translating strings). codon_table = CodonTable.ambiguous_generic_by_id[table_id] # Deal with gaps for translation if hasattr(self.alphabet, "gap_char"): if not gap: gap = self.alphabet.gap_char elif gap != self.alphabet.gap_char: raise ValueError( "Gap {0!r} does not match {1!r} from alphabet".format( gap, self.alphabet.gap_char)) protein = _translate_str(str(self), codon_table, stop_symbol, to_stop, cds, gap=gap) if gap and gap in protein: alphabet = Alphabet.Gapped(codon_table.protein_alphabet, gap) else: alphabet = codon_table.protein_alphabet if stop_symbol in protein: alphabet = Alphabet.HasStopCodon(alphabet, stop_symbol) return Seq(protein, alphabet) def ungap(self, gap=None): """Return a copy of the sequence without the gap character(s). The gap character can be specified in two ways - either as an explicit argument, or via the sequence's alphabet. For example: >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_dna >>> my_dna = Seq("-ATA--TGAAAT-TTGAAAA", generic_dna) >>> my_dna Seq('-ATA--TGAAAT-TTGAAAA', DNAAlphabet()) >>> my_dna.ungap("-") Seq('ATATGAAATTTGAAAA', DNAAlphabet()) If the gap character is not given as an argument, it will be taken from the sequence's alphabet (if defined). Notice that the returned sequence's alphabet is adjusted since it no longer requires a gapped alphabet: >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC, Gapped, HasStopCodon >>> my_pro = Seq("MVVLE=AD*", HasStopCodon(Gapped(IUPAC.protein, "="))) >>> my_pro Seq('MVVLE=AD*', HasStopCodon(Gapped(IUPACProtein(), '='), '*')) >>> my_pro.ungap() Seq('MVVLEAD*', HasStopCodon(IUPACProtein(), '*')) Or, with a simpler gapped DNA example: >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC, Gapped >>> my_seq = Seq("CGGGTAG=AAAAAA", Gapped(IUPAC.unambiguous_dna, "=")) >>> my_seq Seq('CGGGTAG=AAAAAA', Gapped(IUPACUnambiguousDNA(), '=')) >>> my_seq.ungap() Seq('CGGGTAGAAAAAA', IUPACUnambiguousDNA()) As long as it is consistent with the alphabet, although it is redundant, you can still supply the gap character as an argument to this method: >>> my_seq Seq('CGGGTAG=AAAAAA', Gapped(IUPACUnambiguousDNA(), '=')) >>> my_seq.ungap("=") Seq('CGGGTAGAAAAAA', IUPACUnambiguousDNA()) However, if the gap character given as the argument disagrees with that declared in the alphabet, an exception is raised: >>> my_seq Seq('CGGGTAG=AAAAAA', Gapped(IUPACUnambiguousDNA(), '=')) >>> my_seq.ungap("-") Traceback (most recent call last): ... ValueError: Gap '-' does not match '=' from alphabet Finally, if a gap character is not supplied, and the alphabet does not define one, an exception is raised: >>> from Bio.Seq import Seq >>> from Bio.Alphabet import generic_dna >>> my_dna = Seq("ATA--TGAAAT-TTGAAAA", generic_dna) >>> my_dna Seq('ATA--TGAAAT-TTGAAAA', DNAAlphabet()) >>> my_dna.ungap() Traceback (most recent call last): ... ValueError: Gap character not given and not defined in alphabet """ if hasattr(self.alphabet, "gap_char"): if not gap: gap = self.alphabet.gap_char elif gap != self.alphabet.gap_char: raise ValueError( "Gap {0!r} does not match {1!r} from alphabet".format( gap, self.alphabet.gap_char)) alpha = Alphabet._ungap(self.alphabet) elif not gap: raise ValueError("Gap character not given and not defined in " "alphabet") else: alpha = self.alphabet # modify! if len(gap) != 1 or not isinstance(gap, str): raise ValueError("Unexpected gap character, {0!r}".format(gap)) return Seq(str(self).replace(gap, ""), alpha) class UnknownSeq(Seq): """Read-only sequence object of known length but unknown contents. If you have an unknown sequence, you can represent this with a normal Seq object, for example: >>> my_seq = Seq("N"*5) >>> my_seq Seq('NNNNN') >>> len(my_seq) 5 >>> print(my_seq) NNNNN However, this is rather wasteful of memory (especially for large sequences), which is where this class is most useful: >>> unk_five = UnknownSeq(5) >>> unk_five UnknownSeq(5, character='?') >>> len(unk_five) 5 >>> print(unk_five) ????? You can add unknown sequence together, provided their alphabets and characters are compatible, and get another memory saving UnknownSeq: >>> unk_four = UnknownSeq(4) >>> unk_four UnknownSeq(4, character='?') >>> unk_four + unk_five UnknownSeq(9, character='?') If the alphabet or characters don't match up, the addition gives an ordinary Seq object: >>> unk_nnnn = UnknownSeq(4, character="N") >>> unk_nnnn UnknownSeq(4, character='N') >>> unk_nnnn + unk_four Seq('NNNN????') Combining with a real Seq gives a new Seq object: >>> known_seq = Seq("ACGT") >>> unk_four + known_seq Seq('????ACGT') >>> known_seq + unk_four Seq('ACGT????') """ def __init__(self, length, alphabet=Alphabet.generic_alphabet, character=None): """Create a new UnknownSeq object. If character is omitted, it is determined from the alphabet, "N" for nucleotides, "X" for proteins, and "?" otherwise. """ self._length = int(length) if self._length < 0: # TODO - Block zero length UnknownSeq? You can just use a Seq! raise ValueError("Length must not be negative.") self.alphabet = alphabet if character: if len(character) != 1: raise ValueError("character argument should be a single " "letter string.") self._character = character else: base = Alphabet._get_base_alphabet(alphabet) # TODO? Check the case of the letters in the alphabet? # We may have to use "n" instead of "N" etc. if isinstance(base, Alphabet.NucleotideAlphabet): self._character = "N" elif isinstance(base, Alphabet.ProteinAlphabet): self._character = "X" else: self._character = "?" def __len__(self): """Return the stated length of the unknown sequence.""" return self._length def __str__(self): """Return the unknown sequence as full string of the given length.""" return self._character * self._length def __repr__(self): """Return (truncated) representation of the sequence for debugging.""" if self.alphabet is Alphabet.generic_alphabet: # Default used, we can omit it and simplify the representation a = "" else: a = ", alphabet=%r" % self.alphabet return "UnknownSeq({0}{1!s}, character={2!r})".format( self._length, a, self._character) def __add__(self, other): """Add another sequence or string to this sequence. Adding two UnknownSeq objects returns another UnknownSeq object provided the character is the same and the alphabets are compatible. >>> from Bio.Seq import UnknownSeq >>> from Bio.Alphabet import generic_protein >>> UnknownSeq(10, generic_protein) + UnknownSeq(5, generic_protein) UnknownSeq(15, alphabet=ProteinAlphabet(), character='X') If the characters differ, an UnknownSeq object cannot be used, so a Seq object is returned: >>> from Bio.Seq import UnknownSeq >>> from Bio.Alphabet import generic_protein >>> UnknownSeq(10, generic_protein) + UnknownSeq(5, generic_protein, ... character="x") Seq('XXXXXXXXXXxxxxx', ProteinAlphabet()) If adding a string to an UnknownSeq, a new Seq is returned with the same alphabet: >>> from Bio.Seq import UnknownSeq >>> from Bio.Alphabet import generic_protein >>> UnknownSeq(5, generic_protein) + "LV" Seq('XXXXXLV', ProteinAlphabet()) """ if isinstance(other, UnknownSeq) and \ other._character == self._character: # TODO - Check the alphabets match return UnknownSeq(len(self) + len(other), self.alphabet, self._character) # Offload to the base class... return Seq(str(self), self.alphabet) + other def __radd__(self, other): """Add a sequence on the left.""" # If other is an UnknownSeq, then __add__ would be called. # Offload to the base class... return other + Seq(str(self), self.alphabet) def __mul__(self, other): """Multiply UnknownSeq by integer. >>> from Bio.Seq import UnknownSeq >>> from Bio.Alphabet import generic_dna >>> UnknownSeq(3) * 2 UnknownSeq(6, character='?') >>> UnknownSeq(3, generic_dna) * 2 UnknownSeq(6, alphabet=DNAAlphabet(), character='N') """ if not isinstance(other, int): raise TypeError("can't multiply {} by non-int type".format(self.__class__.__name__)) return self.__class__(len(self) * other, self.alphabet) def __rmul__(self, other): """Multiply integer by UnknownSeq. >>> from Bio.Seq import UnknownSeq >>> from Bio.Alphabet import generic_dna >>> 2 * UnknownSeq(3) UnknownSeq(6, character='?') >>> 2 * UnknownSeq(3, generic_dna) UnknownSeq(6, alphabet=DNAAlphabet(), character='N') """ if not isinstance(other, int): raise TypeError("can't multiply {} by non-int type".format(self.__class__.__name__)) return self.__class__(len(self) * other, self.alphabet) def __imul__(self, other): """Multiply UnknownSeq in-place. Note although UnknownSeq is immutable, the in-place method is included to match the behaviour for regular Python strings. >>> from Bio.Seq import UnknownSeq >>> from Bio.Alphabet import generic_dna >>> seq = UnknownSeq(3, generic_dna) >>> seq *= 2 >>> seq UnknownSeq(6, alphabet=DNAAlphabet(), character='N') """ if not isinstance(other, int): raise TypeError("can't multiply {} by non-int type".format(self.__class__.__name__)) return self.__class__(len(self) * other, self.alphabet) def __getitem__(self, index): """Get a subsequence from the UnknownSeq object. >>> unk = UnknownSeq(8, character="N") >>> print(unk[:]) NNNNNNNN >>> print(unk[5:3]) >>> print(unk[1:-1]) NNNNNN >>> print(unk[1:-1:2]) NNN """ if isinstance(index, int): # TODO - Check the bounds without wasting memory return str(self)[index] old_length = self._length step = index.step if step is None or step == 1: # This calculates the length you'd get from ("N"*old_length)[index] start = index.start end = index.stop if start is None: start = 0 elif start < 0: start = max(0, old_length + start) elif start > old_length: start = old_length if end is None: end = old_length elif end < 0: end = max(0, old_length + end) elif end > old_length: end = old_length new_length = max(0, end - start) elif step == 0: raise ValueError("slice step cannot be zero") else: # TODO - handle step efficiently new_length = len(("X" * old_length)[index]) # assert new_length == len(("X"*old_length)[index]), \ # (index, start, end, step, old_length, # new_length, len(("X"*old_length)[index])) return UnknownSeq(new_length, self.alphabet, self._character) def count(self, sub, start=0, end=sys.maxsize): """Return a non-overlapping count, like that of a python string. This behaves like the python string (and Seq object) method of the same name, which does a non-overlapping count! For an overlapping search use the newer count_overlap() method. Returns an integer, the number of occurrences of substring argument sub in the (sub)sequence given by [start:end]. Optional arguments start and end are interpreted as in slice notation. Arguments: - sub - a string or another Seq object to look for - start - optional integer, slice start - end - optional integer, slice end >>> "NNNN".count("N") 4 >>> Seq("NNNN").count("N") 4 >>> UnknownSeq(4, character="N").count("N") 4 >>> UnknownSeq(4, character="N").count("A") 0 >>> UnknownSeq(4, character="N").count("AA") 0 HOWEVER, please note because that python strings and Seq objects (and MutableSeq objects) do a non-overlapping search, this may not give the answer you expect: >>> UnknownSeq(4, character="N").count("NN") 2 >>> UnknownSeq(4, character="N").count("NNN") 1 """ sub_str = self._get_seq_str_and_check_alphabet(sub) len_self, len_sub_str = self._length, len(sub_str) # Handling case where substring not in self if set(sub_str) != set(self._character): return 0 # Setting None to the default arguments if start is None: start = 0 if end is None: end = sys.maxsize # Truncating start and end to max of self._length and min of -self._length start = max(min(start, len_self), -len_self) end = max(min(end, len_self), -len_self) # Convert start and ends to positive indexes if start < 0: start += len_self if end < 0: end += len_self # Handle case where end <= start (no negative step argument here) # and case where len_sub_str is larger than the search space if end <= start or (end - start) < len_sub_str: return 0 # 'Normal' calculation return (end - start) // len_sub_str def count_overlap(self, sub, start=0, end=sys.maxsize): """Return an overlapping count. For a non-overlapping search use the count() method. Returns an integer, the number of occurrences of substring argument sub in the (sub)sequence given by [start:end]. Optional arguments start and end are interpreted as in slice notation. Arguments: - sub - a string or another Seq object to look for - start - optional integer, slice start - end - optional integer, slice end e.g. >>> from Bio.Seq import UnknownSeq >>> UnknownSeq(4, character="N").count_overlap("NN") 3 >>> UnknownSeq(4, character="N").count_overlap("NNN") 2 Where substrings do not overlap, should behave the same as the count() method: >>> UnknownSeq(4, character="N").count_overlap("N") 4 >>> UnknownSeq(4, character="N").count_overlap("N") == UnknownSeq(4, character="N").count("N") True >>> UnknownSeq(4, character="N").count_overlap("A") 0 >>> UnknownSeq(4, character="N").count_overlap("A") == UnknownSeq(4, character="N").count("A") True >>> UnknownSeq(4, character="N").count_overlap("AA") 0 >>> UnknownSeq(4, character="N").count_overlap("AA") == UnknownSeq(4, character="N").count("AA") True """ sub_str = self._get_seq_str_and_check_alphabet(sub) len_self, len_sub_str = self._length, len(sub_str) # Handling case where substring not in self if set(sub_str) != set(self._character): return 0 # Setting None to the default arguments if start is None: start = 0 if end is None: end = sys.maxsize # Truncating start and end to max of self._length and min of -self._length start = max(min(start, len_self), -len_self) end = max(min(end, len_self), -len_self) # Convert start and ends to positive indexes if start < 0: start += len_self if end < 0: end += len_self # Handle case where end <= start (no negative step argument here) # and case where len_sub_str is larger than the search space if end <= start or (end - start) < len_sub_str: return 0 # 'Normal' calculation return end - start - len_sub_str + 1 def complement(self): """Return the complement of an unknown nucleotide equals itself. >>> my_nuc = UnknownSeq(8) >>> my_nuc UnknownSeq(8, character='?') >>> print(my_nuc) ???????? >>> my_nuc.complement() UnknownSeq(8, character='?') >>> print(my_nuc.complement()) ???????? """ if isinstance(Alphabet._get_base_alphabet(self.alphabet), Alphabet.ProteinAlphabet): raise ValueError("Proteins do not have complements!") return self def reverse_complement(self): """Return the reverse complement of an unknown sequence. The reverse complement of an unknown nucleotide equals itself: >>> from Bio.Seq import UnknownSeq >>> from Bio.Alphabet import generic_dna >>> example = UnknownSeq(6, generic_dna) >>> print(example) NNNNNN >>> print(example.reverse_complement()) NNNNNN """ if isinstance(Alphabet._get_base_alphabet(self.alphabet), Alphabet.ProteinAlphabet): raise ValueError("Proteins do not have complements!") return self def transcribe(self): """Return an unknown RNA sequence from an unknown DNA sequence. >>> my_dna = UnknownSeq(10, character="N") >>> my_dna UnknownSeq(10, character='N') >>> print(my_dna) NNNNNNNNNN >>> my_rna = my_dna.transcribe() >>> my_rna UnknownSeq(10, alphabet=RNAAlphabet(), character='N') >>> print(my_rna) NNNNNNNNNN """ # Offload the alphabet stuff s = Seq(self._character, self.alphabet).transcribe() return UnknownSeq(self._length, s.alphabet, self._character) def back_transcribe(self): """Return an unknown DNA sequence from an unknown RNA sequence. >>> my_rna = UnknownSeq(20, character="N") >>> my_rna UnknownSeq(20, character='N') >>> print(my_rna) NNNNNNNNNNNNNNNNNNNN >>> my_dna = my_rna.back_transcribe() >>> my_dna UnknownSeq(20, alphabet=DNAAlphabet(), character='N') >>> print(my_dna) NNNNNNNNNNNNNNNNNNNN """ # Offload the alphabet stuff s = Seq(self._character, self.alphabet).back_transcribe() return UnknownSeq(self._length, s.alphabet, self._character) def upper(self): """Return an upper case copy of the sequence. >>> from Bio.Alphabet import generic_dna >>> from Bio.Seq import UnknownSeq >>> my_seq = UnknownSeq(20, generic_dna, character="n") >>> my_seq UnknownSeq(20, alphabet=DNAAlphabet(), character='n') >>> print(my_seq) nnnnnnnnnnnnnnnnnnnn >>> my_seq.upper() UnknownSeq(20, alphabet=DNAAlphabet(), character='N') >>> print(my_seq.upper()) NNNNNNNNNNNNNNNNNNNN This will adjust the alphabet if required. See also the lower method. """ return UnknownSeq(self._length, self.alphabet._upper(), self._character.upper()) def lower(self): """Return a lower case copy of the sequence. This will adjust the alphabet if required: >>> from Bio.Alphabet import IUPAC >>> from Bio.Seq import UnknownSeq >>> my_seq = UnknownSeq(20, IUPAC.extended_protein) >>> my_seq UnknownSeq(20, alphabet=ExtendedIUPACProtein(), character='X') >>> print(my_seq) XXXXXXXXXXXXXXXXXXXX >>> my_seq.lower() UnknownSeq(20, alphabet=ProteinAlphabet(), character='x') >>> print(my_seq.lower()) xxxxxxxxxxxxxxxxxxxx See also the upper method. """ return UnknownSeq(self._length, self.alphabet._lower(), self._character.lower()) def translate(self, **kwargs): """Translate an unknown nucleotide sequence into an unknown protein. e.g. >>> my_seq = UnknownSeq(9, character="N") >>> print(my_seq) NNNNNNNNN >>> my_protein = my_seq.translate() >>> my_protein UnknownSeq(3, alphabet=ProteinAlphabet(), character='X') >>> print(my_protein) XXX In comparison, using a normal Seq object: >>> my_seq = Seq("NNNNNNNNN") >>> print(my_seq) NNNNNNNNN >>> my_protein = my_seq.translate() >>> my_protein Seq('XXX', ExtendedIUPACProtein()) >>> print(my_protein) XXX """ if isinstance(Alphabet._get_base_alphabet(self.alphabet), Alphabet.ProteinAlphabet): raise ValueError("Proteins cannot be translated!") return UnknownSeq(self._length // 3, Alphabet.generic_protein, "X") def ungap(self, gap=None): """Return a copy of the sequence without the gap character(s). The gap character can be specified in two ways - either as an explicit argument, or via the sequence's alphabet. For example: >>> from Bio.Seq import UnknownSeq >>> from Bio.Alphabet import Gapped, generic_dna >>> my_dna = UnknownSeq(20, Gapped(generic_dna, "-")) >>> my_dna UnknownSeq(20, alphabet=Gapped(DNAAlphabet(), '-'), character='N') >>> my_dna.ungap() UnknownSeq(20, alphabet=DNAAlphabet(), character='N') >>> my_dna.ungap("-") UnknownSeq(20, alphabet=DNAAlphabet(), character='N') If the UnknownSeq is using the gap character, then an empty Seq is returned: >>> my_gap = UnknownSeq(20, Gapped(generic_dna, "-"), character="-") >>> my_gap UnknownSeq(20, alphabet=Gapped(DNAAlphabet(), '-'), character='-') >>> my_gap.ungap() Seq('', DNAAlphabet()) >>> my_gap.ungap("-") Seq('', DNAAlphabet()) Notice that the returned sequence's alphabet is adjusted to remove any explicit gap character declaration. """ # Offload the alphabet stuff s = Seq(self._character, self.alphabet).ungap(gap) if s: return UnknownSeq(self._length, s.alphabet, self._character) else: return Seq("", s.alphabet) class MutableSeq(object): """An editable sequence object (with an alphabet). Unlike normal python strings and our basic sequence object (the Seq class) which are immutable, the MutableSeq lets you edit the sequence in place. However, this means you cannot use a MutableSeq object as a dictionary key. >>> from Bio.Seq import MutableSeq >>> from Bio.Alphabet import generic_dna >>> my_seq = MutableSeq("ACTCGTCGTCG", generic_dna) >>> my_seq MutableSeq('ACTCGTCGTCG', DNAAlphabet()) >>> my_seq[5] 'T' >>> my_seq[5] = "A" >>> my_seq MutableSeq('ACTCGACGTCG', DNAAlphabet()) >>> my_seq[5] 'A' >>> my_seq[5:8] = "NNN" >>> my_seq MutableSeq('ACTCGNNNTCG', DNAAlphabet()) >>> len(my_seq) 11 Note that the MutableSeq object does not support as many string-like or biological methods as the Seq object. """ def __init__(self, data, alphabet=Alphabet.generic_alphabet): """Initialize the class.""" if sys.version_info[0] == 3: self.array_indicator = "u" else: self.array_indicator = "c" if isinstance(data, str): # TODO - What about unicode? self.data = array.array(self.array_indicator, data) else: self.data = data # assumes the input is an array self.alphabet = alphabet def __repr__(self): """Return (truncated) representation of the sequence for debugging.""" if self.alphabet is Alphabet.generic_alphabet: # Default used, we can omit it and simplify the representation a = "" else: a = ", %r" % self.alphabet if len(self) > 60: # Shows the last three letters as it is often useful to see if # there is a stop codon at the end of a sequence. # Note total length is 54+3+3=60 return "{0}('{1}...{2}'{3!s})".format(self.__class__.__name__, str(self[:54]), str(self[-3:]), a) else: return "{0}('{1}'{2!s})".format(self.__class__.__name__, str(self), a) def __str__(self): """Return the full sequence as a python string. Note that Biopython 1.44 and earlier would give a truncated version of repr(my_seq) for str(my_seq). If you are writing code which needs to be backwards compatible with old Biopython, you should continue to use my_seq.tostring() rather than str(my_seq). """ # See test_GAQueens.py for an historic usage of a non-string alphabet! return "".join(self.data) def __eq__(self, other): """Compare the sequence to another sequence or a string (README). Currently if compared to another sequence the alphabets must be compatible. Comparing DNA to RNA, or Nucleotide to Protein will raise an exception. Otherwise only the sequence itself is compared, not the precise alphabet. A future release of Biopython will change this (and the Seq object etc) to use simple string comparison. The plan is that comparing sequences with incompatible alphabets (e.g. DNA to RNA) will trigger a warning but not an exception. During this transition period, please just do explicit comparisons: >>> seq1 = MutableSeq("ACGT") >>> seq2 = MutableSeq("ACGT") >>> id(seq1) == id(seq2) False >>> str(seq1) == str(seq2) True Biopython now does: >>> seq1 == seq2 True >>> seq1 == Seq("ACGT") True >>> seq1 == "ACGT" True """ if hasattr(other, "alphabet"): if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): warnings.warn("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet), BiopythonWarning) if isinstance(other, MutableSeq): return self.data == other.data return str(self) == str(other) def __ne__(self, other): """Implement the not-equal operand.""" # Seem to require this method for Python 2 but not needed on Python 3? return not (self == other) def __lt__(self, other): """Implement the less-than operand.""" if hasattr(other, "alphabet"): if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): warnings.warn("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet), BiopythonWarning) if isinstance(other, MutableSeq): return self.data < other.data if isinstance(other, (str, Seq, UnknownSeq)): return str(self) < str(other) raise TypeError("'<' not supported between instances of '{}' and '{}'" .format(type(self).__name__, type(other).__name__)) def __le__(self, other): """Implement the less-than or equal operand.""" if hasattr(other, "alphabet"): if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): warnings.warn("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet), BiopythonWarning) if isinstance(other, MutableSeq): return self.data <= other.data if isinstance(other, (str, Seq, UnknownSeq)): return str(self) <= str(other) raise TypeError("'<=' not supported between instances of '{}' and '{}'" .format(type(self).__name__, type(other).__name__)) def __gt__(self, other): """Implement the greater-than operand.""" if hasattr(other, "alphabet"): if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): warnings.warn("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet), BiopythonWarning) if isinstance(other, MutableSeq): return self.data > other.data if isinstance(other, (str, Seq, UnknownSeq)): return str(self) > str(other) raise TypeError("'>' not supported between instances of '{}' and '{}'" .format(type(self).__name__, type(other).__name__)) def __ge__(self, other): """Implement the greater-than or equal operand.""" if hasattr(other, "alphabet"): if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): warnings.warn("Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet), BiopythonWarning) if isinstance(other, MutableSeq): return self.data >= other.data if isinstance(other, (str, Seq, UnknownSeq)): return str(self) >= str(other) raise TypeError("'>=' not supported between instances of '{}' and '{}'" .format(type(self).__name__, type(other).__name__)) def __len__(self): """Return the length of the sequence, use len(my_seq).""" return len(self.data) def __getitem__(self, index): """Return a subsequence of single letter, use my_seq[index]. >>> my_seq = MutableSeq('ACTCGACGTCG') >>> my_seq[5] 'A' """ # Note since Python 2.0, __getslice__ is deprecated # and __getitem__ is used instead. # See http://docs.python.org/ref/sequence-methods.html if isinstance(index, int): # Return a single letter as a string return self.data[index] else: # Return the (sub)sequence as another Seq object return MutableSeq(self.data[index], self.alphabet) def __setitem__(self, index, value): """Set a subsequence of single letter via value parameter. >>> my_seq = MutableSeq('ACTCGACGTCG') >>> my_seq[0] = 'T' >>> my_seq MutableSeq('TCTCGACGTCG') """ # Note since Python 2.0, __setslice__ is deprecated # and __setitem__ is used instead. # See http://docs.python.org/ref/sequence-methods.html if isinstance(index, int): # Replacing a single letter with a new string self.data[index] = value else: # Replacing a sub-sequence if isinstance(value, MutableSeq): self.data[index] = value.data elif isinstance(value, type(self.data)): self.data[index] = value else: self.data[index] = array.array(self.array_indicator, str(value)) def __delitem__(self, index): """Delete a subsequence of single letter. >>> my_seq = MutableSeq('ACTCGACGTCG') >>> del my_seq[0] >>> my_seq MutableSeq('CTCGACGTCG') """ # Note since Python 2.0, __delslice__ is deprecated # and __delitem__ is used instead. # See http://docs.python.org/ref/sequence-methods.html # Could be deleting a single letter, or a slice del self.data[index] def __add__(self, other): """Add another sequence or string to this sequence. Returns a new MutableSeq object. """ if hasattr(other, "alphabet"): # other should be a Seq or a MutableSeq if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): raise TypeError( "Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet)) # They should be the same sequence type (or one of them is generic) a = Alphabet._consensus_alphabet([self.alphabet, other.alphabet]) if isinstance(other, MutableSeq): # See test_GAQueens.py for an historic usage of a non-string # alphabet! Adding the arrays should support this. return self.__class__(self.data + other.data, a) else: return self.__class__(str(self) + str(other), a) elif isinstance(other, basestring): # other is a plain string - use the current alphabet return self.__class__(str(self) + str(other), self.alphabet) else: raise TypeError def __radd__(self, other): """Add a sequence on the left. >>> from Bio.Seq import MutableSeq >>> from Bio.Alphabet import generic_protein >>> "LV" + MutableSeq("MELKI", generic_protein) MutableSeq('LVMELKI', ProteinAlphabet()) """ if hasattr(other, "alphabet"): # other should be a Seq or a MutableSeq if not Alphabet._check_type_compatible([self.alphabet, other.alphabet]): raise TypeError( "Incompatible alphabets {0!r} and {1!r}".format( self.alphabet, other.alphabet)) # They should be the same sequence type (or one of them is generic) a = Alphabet._consensus_alphabet([self.alphabet, other.alphabet]) if isinstance(other, MutableSeq): # See test_GAQueens.py for an historic usage of a non-string # alphabet! Adding the arrays should support this. return self.__class__(other.data + self.data, a) else: return self.__class__(str(other) + str(self), a) elif isinstance(other, basestring): # other is a plain string - use the current alphabet return self.__class__(str(other) + str(self), self.alphabet) else: raise TypeError def __mul__(self, other): """Multiply MutableSeq by integer. Note this is not in-place and returns a new object, matching native Python list multiplication. >>> from Bio.Seq import MutableSeq >>> from Bio.Alphabet import generic_dna >>> MutableSeq('ATG') * 2 MutableSeq('ATGATG') >>> MutableSeq('ATG', generic_dna) * 2 MutableSeq('ATGATG', DNAAlphabet()) """ if not isinstance(other, int): raise TypeError("can't multiply {} by non-int type".format(self.__class__.__name__)) return self.__class__(self.data * other, self.alphabet) def __rmul__(self, other): """Multiply integer by MutableSeq. Note this is not in-place and returns a new object, matching native Python list multiplication. >>> from Bio.Seq import MutableSeq >>> from Bio.Alphabet import generic_dna >>> 2 * MutableSeq('ATG') MutableSeq('ATGATG') >>> 2 * MutableSeq('ATG', generic_dna) MutableSeq('ATGATG', DNAAlphabet()) """ if not isinstance(other, int): raise TypeError("can't multiply {} by non-int type".format(self.__class__.__name__)) return self.__class__(self.data * other, self.alphabet) def __imul__(self, other): """Multiply MutableSeq in-place. >>> from Bio.Seq import MutableSeq >>> from Bio.Alphabet import generic_dna >>> seq = MutableSeq('ATG', generic_dna) >>> seq *= 2 >>> seq MutableSeq('ATGATG', DNAAlphabet()) """ if not isinstance(other, int): raise TypeError("can't multiply {} by non-int type".format(self.__class__.__name__)) return self.__class__(self.data * other, self.alphabet) def append(self, c): """Add a subsequence to the mutable sequence object. >>> my_seq = MutableSeq('ACTCGACGTCG') >>> my_seq.append('A') >>> my_seq MutableSeq('ACTCGACGTCGA') No return value. """ self.data.append(c) def insert(self, i, c): """Add a subsequence to the mutable sequence object at a given index. >>> my_seq = MutableSeq('ACTCGACGTCG') >>> my_seq.insert(0,'A') >>> my_seq MutableSeq('AACTCGACGTCG') >>> my_seq.insert(8,'G') >>> my_seq MutableSeq('AACTCGACGGTCG') No return value. """ self.data.insert(i, c) def pop(self, i=(-1)): """Remove a subsequence of a single letter at given index. >>> my_seq = MutableSeq('ACTCGACGTCG') >>> my_seq.pop() 'G' >>> my_seq MutableSeq('ACTCGACGTC') >>> my_seq.pop() 'C' >>> my_seq MutableSeq('ACTCGACGT') Returns the last character of the sequence """ c = self.data[i] del self.data[i] return c def remove(self, item): """Remove a subsequence of a single letter from mutable sequence. >>> my_seq = MutableSeq('ACTCGACGTCG') >>> my_seq.remove('C') >>> my_seq MutableSeq('ATCGACGTCG') >>> my_seq.remove('A') >>> my_seq MutableSeq('TCGACGTCG') No return value. """ for i in range(len(self.data)): if self.data[i] == item: del self.data[i] return raise ValueError("MutableSeq.remove(x): x not in list") def count(self, sub, start=0, end=sys.maxsize): """Return a non-overlapping count, like that of a python string. This behaves like the python string method of the same name, which does a non-overlapping count! For an overlapping search use the newer count_overlap() method. Returns an integer, the number of occurrences of substring argument sub in the (sub)sequence given by [start:end]. Optional arguments start and end are interpreted as in slice notation. Arguments: - sub - a string or another Seq object to look for - start - optional integer, slice start - end - optional integer, slice end e.g. >>> from Bio.Seq import MutableSeq >>> my_mseq = MutableSeq("AAAATGA") >>> print(my_mseq.count("A")) 5 >>> print(my_mseq.count("ATG")) 1 >>> print(my_mseq.count(Seq("AT"))) 1 >>> print(my_mseq.count("AT", 2, -1)) 1 HOWEVER, please note because that python strings, Seq objects and MutableSeq objects do a non-overlapping search, this may not give the answer you expect: >>> "AAAA".count("AA") 2 >>> print(MutableSeq("AAAA").count("AA")) 2 An overlapping search would give the answer as three! """ try: # TODO - Should we check the alphabet? search = str(sub) except AttributeError: search = sub if not isinstance(search, basestring): raise TypeError("expected a string, Seq or MutableSeq") if len(search) == 1: # Try and be efficient and work directly from the array. count = 0 for c in self.data[start:end]: if c == search: count += 1 return count else: # TODO - Can we do this more efficiently? return str(self).count(search, start, end) def count_overlap(self, sub, start=0, end=sys.maxsize): """Return an overlapping count. For a non-overlapping search use the count() method. Returns an integer, the number of occurrences of substring argument sub in the (sub)sequence given by [start:end]. Optional arguments start and end are interpreted as in slice notation. Arguments: - sub - a string or another Seq object to look for - start - optional integer, slice start - end - optional integer, slice end e.g. >>> from Bio.Seq import MutableSeq >>> print(MutableSeq("AAAA").count_overlap("AA")) 3 >>> print(MutableSeq("ATATATATA").count_overlap("ATA")) 4 >>> print(MutableSeq("ATATATATA").count_overlap("ATA", 3, -1)) 1 Where substrings do not overlap, should behave the same as the count() method: >>> from Bio.Seq import MutableSeq >>> my_mseq = MutableSeq("AAAATGA") >>> print(my_mseq.count_overlap("A")) 5 >>> my_mseq.count_overlap("A") == my_mseq.count("A") True >>> print(my_mseq.count_overlap("ATG")) 1 >>> my_mseq.count_overlap("ATG") == my_mseq.count("ATG") True >>> print(my_mseq.count_overlap(Seq("AT"))) 1 >>> my_mseq.count_overlap(Seq("AT")) == my_mseq.count(Seq("AT")) True >>> print(my_mseq.count_overlap("AT", 2, -1)) 1 >>> my_mseq.count_overlap("AT", 2, -1) == my_mseq.count("AT", 2, -1) True HOWEVER, do not use this method for such cases because the count() method is much for efficient. """ # The implementation is currently identical to that of # Seq.count_overlap() apart from the definition of sub_str sub_str = str(sub) self_str = str(self) overlap_count = 0 while True: start = self_str.find(sub_str, start, end) + 1 if start != 0: overlap_count += 1 else: return overlap_count def index(self, item): """Return first occurrence position of a single entry (i.e. letter). >>> my_seq = MutableSeq('ACTCGACGTCG') >>> my_seq.index('A') 0 >>> my_seq.index('T') 2 Note unlike a Biopython Seq object, or Python string, multi-letter subsequences are not supported. """ for i in range(len(self.data)): if self.data[i] == item: return i raise ValueError("MutableSeq.index(x): x not in list") def reverse(self): """Modify the mutable sequence to reverse itself. No return value. """ self.data.reverse() def complement(self): """Modify the mutable sequence to take on its complement. Trying to complement a protein sequence raises an exception. No return value. """ if isinstance(Alphabet._get_base_alphabet(self.alphabet), Alphabet.ProteinAlphabet): raise ValueError("Proteins do not have complements!") if self.alphabet in (IUPAC.ambiguous_dna, IUPAC.unambiguous_dna): d = ambiguous_dna_complement elif self.alphabet in (IUPAC.ambiguous_rna, IUPAC.unambiguous_rna): d = ambiguous_rna_complement elif 'U' in self.data and 'T' in self.data: # TODO - Handle this cleanly? raise ValueError("Mixed RNA/DNA found") elif 'U' in self.data: d = ambiguous_rna_complement else: d = ambiguous_dna_complement mixed = d.copy() # We're going to edit this to be mixed case! mixed.update((x.lower(), y.lower()) for x, y in d.items()) self.data = [mixed[_] for _ in self.data] self.data = array.array(self.array_indicator, self.data) def reverse_complement(self): """Modify the mutable sequence to take on its reverse complement. Trying to reverse complement a protein sequence raises an exception. No return value. """ self.complement() self.data.reverse() def extend(self, other): """Add a sequence to the original mutable sequence object. >>> my_seq = MutableSeq('ACTCGACGTCG') >>> my_seq.extend('A') >>> my_seq MutableSeq('ACTCGACGTCGA') >>> my_seq.extend('TTT') >>> my_seq MutableSeq('ACTCGACGTCGATTT') No return value. """ if isinstance(other, MutableSeq): for c in other.data: self.data.append(c) else: for c in other: self.data.append(c) def toseq(self): """Return the full sequence as a new immutable Seq object. >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> my_mseq = MutableSeq("MKQHKAMIVALIVICITAVVAAL", ... IUPAC.protein) >>> my_mseq MutableSeq('MKQHKAMIVALIVICITAVVAAL', IUPACProtein()) >>> my_mseq.toseq() Seq('MKQHKAMIVALIVICITAVVAAL', IUPACProtein()) Note that the alphabet is preserved. """ return Seq("".join(self.data), self.alphabet) # The transcribe, backward_transcribe, and translate functions are # user-friendly versions of the corresponding functions in Bio.Transcribe # and Bio.Translate. The functions work both on Seq objects, and on strings. def transcribe(dna): """Transcribe a DNA sequence into RNA. If given a string, returns a new string object. Given a Seq or MutableSeq, returns a new Seq object with an RNA alphabet. Trying to transcribe a protein or RNA sequence raises an exception. e.g. >>> transcribe("ACTGN") 'ACUGN' """ if isinstance(dna, Seq): return dna.transcribe() elif isinstance(dna, MutableSeq): return dna.toseq().transcribe() else: return dna.replace('T', 'U').replace('t', 'u') def back_transcribe(rna): """Return the RNA sequence back-transcribed into DNA. If given a string, returns a new string object. Given a Seq or MutableSeq, returns a new Seq object with an RNA alphabet. Trying to transcribe a protein or DNA sequence raises an exception. e.g. >>> back_transcribe("ACUGN") 'ACTGN' """ if isinstance(rna, Seq): return rna.back_transcribe() elif isinstance(rna, MutableSeq): return rna.toseq().back_transcribe() else: return rna.replace('U', 'T').replace('u', 't') def _translate_str(sequence, table, stop_symbol="*", to_stop=False, cds=False, pos_stop="X", gap=None): """Translate nucleotide string into a protein string (PRIVATE). Arguments: - sequence - a string - table - a CodonTable object (NOT a table name or id number) - stop_symbol - a single character string, what to use for terminators. - to_stop - boolean, should translation terminate at the first in frame stop codon? If there is no in-frame stop codon then translation continues to the end. - pos_stop - a single character string for a possible stop codon (e.g. TAN or NNN) - cds - Boolean, indicates this is a complete CDS. If True, this checks the sequence starts with a valid alternative start codon (which will be translated as methionine, M), that the sequence length is a multiple of three, and that there is a single in frame stop codon at the end (this will be excluded from the protein sequence, regardless of the to_stop option). If these tests fail, an exception is raised. - gap - Single character string to denote symbol used for gaps. Defaults to None. Returns a string. e.g. >>> from Bio.Data import CodonTable >>> table = CodonTable.ambiguous_dna_by_id[1] >>> _translate_str("AAA", table) 'K' >>> _translate_str("TAR", table) '*' >>> _translate_str("TAN", table) 'X' >>> _translate_str("TAN", table, pos_stop="@") '@' >>> _translate_str("TA?", table) Traceback (most recent call last): ... Bio.Data.CodonTable.TranslationError: Codon 'TA?' is invalid In a change to older versions of Biopython, partial codons are now always regarded as an error (previously only checked if cds=True) and will trigger a warning (likely to become an exception in a future release). If **cds=True**, the start and stop codons are checked, and the start codon will be translated at methionine. The sequence must be an while number of codons. >>> _translate_str("ATGCCCTAG", table, cds=True) 'MP' >>> _translate_str("AAACCCTAG", table, cds=True) Traceback (most recent call last): ... Bio.Data.CodonTable.TranslationError: First codon 'AAA' is not a start codon >>> _translate_str("ATGCCCTAGCCCTAG", table, cds=True) Traceback (most recent call last): ... Bio.Data.CodonTable.TranslationError: Extra in frame stop codon found. """ sequence = sequence.upper() amino_acids = [] forward_table = table.forward_table stop_codons = table.stop_codons if table.nucleotide_alphabet.letters is not None: valid_letters = set(table.nucleotide_alphabet.letters.upper()) else: # Assume the worst case, ambiguous DNA or RNA: valid_letters = set(_ambiguous_dna_letters.upper() + _ambiguous_rna_letters.upper()) n = len(sequence) # Check for tables with 'ambiguous' (dual-coding) stop codons: dual_coding = [c for c in stop_codons if c in forward_table] if dual_coding: c = dual_coding[0] if to_stop: raise ValueError("You cannot use 'to_stop=True' with this table " "as it contains {} codon(s) which can be both " " STOP and an amino acid (e.g. '{}' -> '{}' or " "STOP)." .format(len(dual_coding), c, forward_table[c])) warnings.warn("This table contains {} codon(s) which code(s) for both " "STOP and an amino acid (e.g. '{}' -> '{}' or STOP). " "Such codons will be translated as amino acid." .format(len(dual_coding), c, forward_table[c]), BiopythonWarning) if cds: if str(sequence[:3]).upper() not in table.start_codons: raise CodonTable.TranslationError( "First codon '{0}' is not a start codon".format(sequence[:3])) if n % 3 != 0: raise CodonTable.TranslationError( "Sequence length {0} is not a multiple of three".format(n)) if str(sequence[-3:]).upper() not in stop_codons: raise CodonTable.TranslationError( "Final codon '{0}' is not a stop codon".format(sequence[-3:])) # Don't translate the stop symbol, and manually translate the M sequence = sequence[3:-3] n -= 6 amino_acids = ["M"] elif n % 3 != 0: warnings.warn("Partial codon, len(sequence) not a multiple of three. " "Explicitly trim the sequence or add trailing N before " "translation. This may become an error in future.", BiopythonWarning) if gap is not None: if not isinstance(gap, basestring): raise TypeError("Gap character should be a single character " "string.") elif len(gap) > 1: raise ValueError("Gap character should be a single character " "string.") for i in range(0, n - n % 3, 3): codon = sequence[i:i + 3] try: amino_acids.append(forward_table[codon]) except (KeyError, CodonTable.TranslationError): if codon in table.stop_codons: if cds: raise CodonTable.TranslationError( "Extra in frame stop codon found.") if to_stop: break amino_acids.append(stop_symbol) elif valid_letters.issuperset(set(codon)): # Possible stop codon (e.g. NNN or TAN) amino_acids.append(pos_stop) elif gap is not None and codon == gap * 3: # Gapped translation amino_acids.append(gap) else: raise CodonTable.TranslationError( "Codon '{0}' is invalid".format(codon)) return "".join(amino_acids) def translate(sequence, table="Standard", stop_symbol="*", to_stop=False, cds=False, gap=None): """Translate a nucleotide sequence into amino acids. If given a string, returns a new string object. Given a Seq or MutableSeq, returns a Seq object with a protein alphabet. Arguments: - table - Which codon table to use? This can be either a name (string), an NCBI identifier (integer), or a CodonTable object (useful for non-standard genetic codes). Defaults to the "Standard" table. - stop_symbol - Single character string, what to use for any terminators, defaults to the asterisk, "*". - to_stop - Boolean, defaults to False meaning do a full translation continuing on past any stop codons (translated as the specified stop_symbol). If True, translation is terminated at the first in frame stop codon (and the stop_symbol is not appended to the returned protein sequence). - cds - Boolean, indicates this is a complete CDS. If True, this checks the sequence starts with a valid alternative start codon (which will be translated as methionine, M), that the sequence length is a multiple of three, and that there is a single in frame stop codon at the end (this will be excluded from the protein sequence, regardless of the to_stop option). If these tests fail, an exception is raised. - gap - Single character string to denote symbol used for gaps. Defaults to None. A simple string example using the default (standard) genetic code: >>> coding_dna = "GTGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG" >>> translate(coding_dna) 'VAIVMGR*KGAR*' >>> translate(coding_dna, stop_symbol="@") 'VAIVMGR@KGAR@' >>> translate(coding_dna, to_stop=True) 'VAIVMGR' Now using NCBI table 2, where TGA is not a stop codon: >>> translate(coding_dna, table=2) 'VAIVMGRWKGAR*' >>> translate(coding_dna, table=2, to_stop=True) 'VAIVMGRWKGAR' In fact this example uses an alternative start codon valid under NCBI table 2, GTG, which means this example is a complete valid CDS which when translated should really start with methionine (not valine): >>> translate(coding_dna, table=2, cds=True) 'MAIVMGRWKGAR' Note that if the sequence has no in-frame stop codon, then the to_stop argument has no effect: >>> coding_dna2 = "GTGGCCATTGTAATGGGCCGC" >>> translate(coding_dna2) 'VAIVMGR' >>> translate(coding_dna2, to_stop=True) 'VAIVMGR' NOTE - Ambiguous codons like "TAN" or "NNN" could be an amino acid or a stop codon. These are translated as "X". Any invalid codon (e.g. "TA?" or "T-A") will throw a TranslationError. It will however translate either DNA or RNA. NOTE - Since version 1.71 Biopython contains codon tables with 'ambiguous stop codons'. These are stop codons with unambiguous sequence but which have a context dependent coding as STOP or as amino acid. With these tables 'to_stop' must be False (otherwise a ValueError is raised). The dual coding codons will always be translated as amino acid, except for 'cds=True', where the last codon will be translated as STOP. >>> coding_dna3 = "ATGGCACGGAAGTGA" >>> translate(coding_dna3) 'MARK*' >>> translate(coding_dna3, table=27) # Table 27: TGA -> STOP or W 'MARKW' It will however raise a BiopythonWarning (not shown). >>> translate(coding_dna3, table=27, cds=True) 'MARK' >>> translate(coding_dna3, table=27, to_stop=True) Traceback (most recent call last): ... ValueError: You cannot use 'to_stop=True' with this table ... """ if isinstance(sequence, Seq): return sequence.translate(table, stop_symbol, to_stop, cds) elif isinstance(sequence, MutableSeq): # Return a Seq object return sequence.toseq().translate(table, stop_symbol, to_stop, cds) else: # Assume its a string, return a string try: codon_table = CodonTable.ambiguous_generic_by_id[int(table)] except ValueError: codon_table = CodonTable.ambiguous_generic_by_name[table] except (AttributeError, TypeError): if isinstance(table, CodonTable.CodonTable): codon_table = table else: raise ValueError('Bad table argument') return _translate_str(sequence, codon_table, stop_symbol, to_stop, cds, gap=gap) def reverse_complement(sequence): """Return the reverse complement sequence of a nucleotide string. If given a string, returns a new string object. Given a Seq or a MutableSeq, returns a new Seq object with the same alphabet. Supports unambiguous and ambiguous nucleotide sequences. e.g. >>> reverse_complement("ACTG-NH") 'DN-CAGT' """ return complement(sequence)[::-1] def complement(sequence): """Return the complement sequence of a nucleotide string. If given a string, returns a new string object. Given a Seq or a MutableSeq, returns a new Seq object with the same alphabet. Supports unambiguous and ambiguous nucleotide sequences. e.g. >>> complement("ACTG-NH") 'TGAC-ND' """ if isinstance(sequence, Seq): # Return a Seq return sequence.complement() elif isinstance(sequence, MutableSeq): # Return a Seq # Don't use the MutableSeq reverse_complement method as it is # 'in place'. return sequence.toseq().complement() # Assume its a string. # In order to avoid some code duplication, the old code would turn the # string into a Seq, use the reverse_complement method, and convert back # to a string. # This worked, but is over five times slower on short sequences! if ('U' in sequence or 'u' in sequence) \ and ('T' in sequence or 't' in sequence): raise ValueError("Mixed RNA/DNA found") elif 'U' in sequence or 'u' in sequence: ttable = _rna_complement_table else: ttable = _dna_complement_table return sequence.translate(ttable) def _test(): """Run the Bio.Seq module's doctests (PRIVATE).""" print("Running doctests...") import doctest doctest.testmod(optionflags=doctest.IGNORE_EXCEPTION_DETAIL) print("Done") if __name__ == "__main__": _test()