#!/usr/bin/env python # # Copyright 2002 by Michael Hoffman. All rights reserved. # This code is part of the Biopython distribution and governed by its # license. Please see the LICENSE file that should have been included # as part of this package. """Bio.GFF.easy: some functions to ease the use of Biopython (DEPRECATED) This is part of the "old" Bio.GFF module by Michael Hoffman, which offered access to a MySQL database holding GFF data loaded by BioPerl. This code has now been deprecated, and will probably be removed in order to free the Bio.GFF namespace for a new GFF parser in Biopython (including GFF3 support). Some of the more useful ideas of Bio.GFF.easy may be reworked for Bio.GenBank, using the standard SeqFeature objects used elsewhere in Biopython. """ import copy import re import sys import Bio from Bio import GenBank from Bio.Data import IUPACData from Bio.Seq import Seq from Bio import SeqIO from Bio import SeqUtils import GenericTools class FeatureDict(dict): """ JH: accessing feature.qualifiers as a list is stupid. Here's a dict that does it""" def __init__(self, feature_list, default=None): dict.__init__(self) self.default = default key_re = re.compile(r'/(\S+)=') for i in feature_list: key = key_re.match(i.key).group(1) val = i.value.replace('"','') self[key] = val def __getitem__(self, key): try: return dict.__getitem__(self, key) except KeyError: return self.default class Location(GenericTools.VerboseList): """ this is really best interfaced through LocationFromString fuzzy: < or > join: {0 = no join, 1 = join, 2 = order} >>> location = Location([Location([339]), Location([564])]) # zero-based >>> location Location(Location(339), Location(564)) >>> print location # one-based 340..565 >>> print location.five_prime() 340 >>> location_rev = Location([Location([339]), Location([564])], 1) >>> print location_rev complement(340..565) >>> print location_rev.five_prime() 565 """ def __init__(self, the_list, complement=0, seqname=None): self.complement = complement self.join = 0 self.fuzzy = None self.seqname = seqname list.__init__(self, the_list) def _joinstr(self): if self.join == 1: label = 'join' elif self.join == 2: label = 'order' return "%s(%s)" % (label, ",".join(map(str, self))) def __str__(self): if self.seqname: format = "%s:%%s" % self.seqname else: format = "%s" if self.complement: format = format % "complement(%s)" if self.join: return format % self._joinstr() elif isinstance(self[0], list): return format % "%s..%s" % (str(self[0]), str(self[1])) else: if self.fuzzy: format = format % self.fuzzy + "%s" return format % str(self[0] + 1) def __repr__(self): return "Location(%s)" % ", ".join(map(repr, self)) direction2index = {1: 0, -1: -1} def direction_and_index(self, direction): """ 1: 5' -1: 3' >>> loc1 = LocationFromString("join(1..3,complement(5..6))") >>> loc1.direction_and_index(1) (1, 0) >>> loc1.direction_and_index(-1) (-1, -1) >>> loc1.reverse() >>> print loc1 complement(join(1..3,complement(5..6))) >>> loc1.direction_and_index(1) (-1, -1) """ if self.complement: direction = direction * -1 index = self.direction2index[direction] return direction, index def findside(self, direction): """ >>> loc = LocationFromString("complement(join(1..5,complement(6..10)))") >>> loc.findside(1) Location(5) >>> loc.findside(-1) Location(0) """ direction, index = self.direction_and_index(direction) if self.join or isinstance(self[0], list): return self[index].findside(direction) else: return self def findseqname_3prime(self): """ >>> loc = LocationFromString("complement(join(MOOCOW:1..5,SEQ:complement(6..10)))") >>> loc.findseqname_3prime() 'MOOCOW' """ return self.findseqname(-1) def findseqname(self, direction=1): # find 5' seqname """ >>> loc = LocationFromString("complement(join(MOOCOW:1..5,SEQ:complement(6..10)))") >>> loc.findseqname() 'SEQ' >>> loc.findseqname(-1) 'MOOCOW' """ direction, index = self.direction_and_index(direction) if self.seqname: return self.seqname elif self.join: return self[index].findseqname(direction) else: raise AttributeError('no sequence name') def five_prime(self): return self.findside(1) def three_prime(self): return self.findside(-1) def length(self): """ WARNING: doesn't deal with joins!!!! """ return self.end()-self.start() def intersection(self, other): """ WARNING: doesn't deal with joins!!!! >>> location1 = LocationFromString("1..50") >>> location2 = LocationFromString("25..200") >>> print location1.intersection(location2) 25..50 >>> print location1.intersection(location2) 25..50 """ if self.start() >= other.start(): start = self.start() else: start = other.start() if self.end() <= other.end(): end = self.end() else: end = other.end() return Location([Location([start]), Location([end])]) def start(self): # zero-based if self.complement: return self.three_prime()[0] else: return self.five_prime()[0] def end(self): # zero-based if self.complement: return self.five_prime()[0] else: return self.three_prime()[0] def three_prime_range(self, window): three_prime_loc = self.three_prime() if self.complement: return Location([three_prime_loc-window, three_prime_loc], complement=1) else: return Location([three_prime_loc, three_prime_loc+window]) def sublocation(self, sub_location): """ >>> fwd_location = LocationFromString('X:5830132..5831528') >>> print fwd_location.sublocation(LocationFromString('1..101')) X:5830132..5830232 >>> print fwd_location.sublocation(LocationFromString('1267..1286')) X:5831398..5831417 >>> rev_location = LocationFromString('I:complement(8415686..8416216)') >>> print rev_location.sublocation(LocationFromString('1..101')) I:complement(8416116..8416216) >>> print rev_location.sublocation(LocationFromString('100..200')) I:complement(8416017..8416117) """ absolute_location = copy.deepcopy(self) for i in xrange(2): absolute_location[i] = self.five_prime().add(sub_location[i], self.complement) if absolute_location.complement: list.reverse(absolute_location) return absolute_location def __add__(self, addend): return self.add(addend) def add(self, addend, complement=0): self_copy = copy.deepcopy(self) if isinstance(addend, Location): addend = addend[0] if complement: addend *= -1 self_copy[0] += addend return self_copy def __sub__(self, subtrahend): return self + -subtrahend def reverse(self): self.complement = [1, 0][self.complement] def reorient(self): """ >>> loc1 = LocationFromString("join(I:complement(1..9000),I:complement(9001..10000))") >>> loc1.reorient() >>> print loc1 complement(join(I:1..9000,I:9001..10000)) >>> loc2 = LocationFromString("join(I:complement(1..9000),I:9001..10000)") >>> loc2.reorient() >>> print loc2 join(I:complement(1..9000),I:9001..10000) """ if self.join: if len([x for x in self if x.complement]) == len(self): self.reverse() for segment in self: segment.reverse() def bounding(self): """ works for single level non-complex joins >>> LOC = LocationFromString >>> l1 = LOC("join(alpha:1..30,alpha:50..70)") >>> print l1.bounding() join(alpha:1..70) >>> l2 = LOC("join(alpha:1..30,alpha:complement(50..70))") >>> print l2.bounding() join(alpha:1..30,alpha:complement(50..70)) >>> l3 = LOC("join(alpha:1..30,alpha:complement(50..70),beta:6..20,alpha:25..45)") >>> print l3.bounding() join(alpha:1..45,alpha:complement(50..70),beta:6..20) """ if not self.join: return seqdict = {} seqkeys = [] for subloc in self: assert subloc.seqname assert not subloc.join try: seqdict[_hashname(subloc)].append(subloc) except KeyError: key = _hashname(subloc) seqdict[key] = [subloc] seqkeys.append(key) res = LocationJoin() for key in seqkeys: locations = seqdict[key] coords = [] for subloc in locations: coords.append(subloc.start()) coords.append(subloc.end()) res.append(LocationFromCoords(min(coords), max(coords), locations[0].complement, locations[0].seqname)) return res def _hashname(location): return str(location.complement) + location.seqname class LocationJoin(Location): """ >>> join = LocationJoin([LocationFromCoords(339, 564, 1), LocationFromString("complement(100..339)")]) >>> appendloc = LocationFromString("order(complement(66..99),complement(5..55))") >>> join.append(appendloc) >>> print join join(complement(340..565),complement(100..339),order(complement(66..99),complement(5..55))) >>> join2 = LocationJoin() >>> join2.append(LocationFromString("complement(66..99)")) >>> join2.append(LocationFromString("complement(5..55)")) >>> print join2 join(complement(66..99),complement(5..55)) """ def __init__(self, the_list = [], complement=0, seqname=None): self.complement = complement self.join = 1 self.fuzzy = None self.seqname = seqname list.__init__(self, the_list) class LocationFromCoords(Location): """ >>> print LocationFromCoords(339, 564) 340..565 >>> print LocationFromCoords(339, 564, seqname="I") I:340..565 >>> print LocationFromCoords(999, 3234, "-", seqname="NC_343434") NC_343434:complement(1000..3235) """ def __init__(self, start, end, strand=0, seqname=None): if strand == "+": strand = 0 elif strand == "-": strand = 1 Location.__init__(self, [Location([start]), Location([end])], strand, seqname) # see http://www.ncbi.nlm.nih.gov/collab/FT/index.html#backus-naur # for how this should actually be implemented re_complement = re.compile(r"^complement\((.*)\)$") re_seqname = re.compile(r"^(?!join|order|complement)([^\:]+?):(.*)$") # not every character is allowed by spec re_join = re.compile(r"^(join|order)\((.*)\)$") re_dotdot = re.compile(r"^([><]*\d+)\.\.([><]*\d+)$") re_fuzzy = re.compile(r"^([><])(\d+)") class LocationFromString(Location): """ >>> # here are some tests from http://www.ncbi.nlm.nih.gov/collab/FT/index.html#location >>> print LocationFromString("467") 467 >>> print LocationFromString("340..565") 340..565 >>> print LocationFromString("<345..500") <345..500 >>> print LocationFromString("<1..888") <1..888 >>> # (102.110) and 123^124 syntax unimplemented >>> print LocationFromString("join(12..78,134..202)") join(12..78,134..202) >>> print LocationFromString("complement(join(2691..4571,4918..5163))") complement(join(2691..4571,4918..5163)) >>> print LocationFromString("join(complement(4918..5163),complement(2691..4571))") join(complement(4918..5163),complement(2691..4571)) >>> print LocationFromString("order(complement(4918..5163),complement(2691..4571))") order(complement(4918..5163),complement(2691..4571)) >>> print LocationFromString("NC_001802x.fna:73..78") NC_001802x.fna:73..78 >>> print LocationFromString("J00194:100..202") J00194:100..202 >>> print LocationFromString("join(117505..118584,1..609)") join(117505..118584,1..609) >>> print LocationFromString("join(test3:complement(4..6),test3:complement(1..3))") join(test3:complement(4..6),test3:complement(1..3)) >>> print LocationFromString("test3:join(test1:complement(1..3),4..6)") test3:join(test1:complement(1..3),4..6) """ def __init__(self, location_str): match_seqname = re_seqname.match(location_str) if match_seqname: self.seqname = match_seqname.group(1) location_str = match_seqname.group(2) else: self.seqname = None match_complement = re_complement.match(location_str) if match_complement: self.complement = 1 location_str = match_complement.group(1) else: self.complement = 0 match_join = re_join.match(location_str) if match_join: self.join = {'join':1, 'order':2}[match_join.group(1)] list.__init__(self, map(lambda x: LocationFromString(x), match_join.group(2).split(","))) else: self.join = 0 match_dotdot = re_dotdot.match(location_str) if match_dotdot: list.__init__(self, map(lambda x: LocationFromString(match_dotdot.group(x)), (1, 2))) else: match_fuzzy = re_fuzzy.match(location_str) if match_fuzzy: self.fuzzy = match_fuzzy.group(1) location_str = match_fuzzy.group(2) else: self.fuzzy = None list.__init__(self, [int(location_str)-1]) # zero based, nip it in the bud def open_file(filename): if filename: return open(filename) else: return sys.stdin def fasta_single(filename=None, string=None): """ >>> record = fasta_single(string=''' ... >gi|9629360|ref|NP_057850.1| Gag [Human immunodeficiency virus type 1] ... MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQT ... GSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQG ... QMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAA ... EWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPT ... SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTAC ... QGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEG ... HQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLR ... SLFGNDPSSQ ... ''') >>> record.id 'gi|9629360|ref|NP_057850.1|' >>> record.description 'gi|9629360|ref|NP_057850.1| Gag [Human immunodeficiency virus type 1]' >>> record.seq[0:5] Seq('MGARA', SingleLetterAlphabet()) """ #Returns the first record in a fasta file as a SeqRecord, #or None if there are no records in the file. if string: import cStringIO handle = cStringIO.StringIO(string) else: handle = open_file(filename) try: record = SeqIO.parse(handle, format="fasta").next() except StopIteration: record = None return record def fasta_multi(filename=None): #Simple way is just: #return SeqIO.parse(open_file(filename), format="fasta") #However, for backwards compatibility make sure we raise #the StopIteration exception rather than returning None. reader = SeqIO.parse(open_file(filename), format="fasta") while True: record = reader.next() if record is None: raise StopIteration else: yield record def fasta_readrecords(filename=None): """ >>> records = fasta_readrecords('GFF/multi.fna') >>> records[0].id 'test1' >>> records[2].seq Seq('AAACACAC', SingleLetterAlphabet()) """ return list(SeqIO.parse(open_file(filename), format="fasta")) def fasta_write(filename, records): handle = open(filename, "w") SeqIO.write(records, handle, format="fasta") handle.close() def genbank_single(filename): """ >>> record = genbank_single("GFF/NC_001422.gbk") >>> record.taxonomy ['Viruses', 'ssDNA viruses', 'Microviridae', 'Microvirus'] >>> cds = record.features[-4] >>> cds.key 'CDS' >>> location = LocationFromString(cds.location) >>> print location 2931..3917 >>> subseq = record_subseq(record, location) >>> subseq[0:20] Seq('ATGTTTGGTGCTATTGCTGG', Alphabet()) """ return GenBank.RecordParser().parse(open(filename)) def record_subseq(record, location, *args, **keywds): """ >>> from Bio.SeqRecord import SeqRecord >>> record = SeqRecord(Seq("gagttttatcgcttccatga"), ... "ref|NC_001422", ... "Coliphage phiX174, complete genome", ... "bases 1-11") >>> record_subseq(record, LocationFromString("1..4")) # one-based Seq('GAGT', Alphabet()) >>> record_subseq(record, LocationFromString("complement(1..4)")) # one-based Seq('ACTC', Alphabet()) >>> record_subseq(record, LocationFromString("join(complement(1..4),1..4)")) # what an idea! Seq('ACTCGAGT', Alphabet()) >>> loc = LocationFromString("complement(join(complement(5..7),1..4))") >>> print loc complement(join(complement(5..7),1..4)) >>> record_subseq(record, loc) Seq('ACTCTTT', Alphabet()) >>> print loc complement(join(complement(5..7),1..4)) >>> loc.reverse() >>> record_subseq(record, loc) Seq('AAAGAGT', Alphabet()) >>> record_subseq(record, loc, upper=1) Seq('AAAGAGT', Alphabet()) """ if location.join: subsequence_list = [] if location.complement: location_copy = copy.copy(location) list.reverse(location_copy) else: location_copy = location for sublocation in location_copy: if location.complement: sublocation_copy = copy.copy(sublocation) sublocation_copy.reverse() else: sublocation_copy = sublocation subsequence_list.append(record_subseq(record, sublocation_copy, *args, **keywds).tostring()) return Seq(''.join(subsequence_list), record_sequence(record).alphabet) else: return record_coords(record, location.start(), location.end()+1, location.complement, *args, **keywds) def record_sequence(record): """ returns the sequence of a record can be Bio.SeqRecord.SeqRecord or Bio.GenBank.Record.Record """ if isinstance(record, Bio.SeqRecord.SeqRecord): return record.seq elif isinstance(record, Bio.GenBank.Record.Record): return Seq(record.sequence) else: raise TypeError('not Bio.SeqRecord.SeqRecord or Bio.GenBank.Record.Record') def record_coords(record, start, end, strand=0, upper=0): """ >>> from Bio.SeqRecord import SeqRecord >>> record = SeqRecord(Seq("gagttttatcgcttccatga"), ... "ref|NC_001422", ... "Coliphage phiX174, complete genome", ... "bases 1-11") >>> record_coords(record, 0, 4) # zero-based Seq('GAGT', Alphabet()) >>> record_coords(record, 0, 4, "-") # zero-based Seq('ACTC', Alphabet()) >>> record_coords(record, 0, 4, "-", upper=1) # zero-based Seq('ACTC', Alphabet()) """ subseq = record_sequence(record)[start:end] subseq_str = subseq.tostring() subseq_str = subseq_str.upper() subseq = Seq(subseq_str, subseq.alphabet) if strand == '-' or strand == 1: return subseq.reverse_complement() else: return subseq def _test(): """Run the Bio.GFF.easy module's doctests (PRIVATE). This will try and locate the unit tests directory, and run the doctests from there in order that the relative paths used in the examples work. """ import doctest import os if os.path.isdir(os.path.join("..","..","Tests")): print "Runing doctests..." cur_dir = os.path.abspath(os.curdir) os.chdir(os.path.join("..","..","Tests")) doctest.testmod() os.chdir(cur_dir) del cur_dir print "Done" elif os.path.isdir(os.path.join("Tests")) : print "Runing doctests..." cur_dir = os.path.abspath(os.curdir) os.chdir(os.path.join("Tests")) doctest.testmod() os.chdir(cur_dir) del cur_dir print "Done" if __name__ == "__main__": if __debug__: _test()