BLASTP 2.0.11 [Jan-20-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|120291|sp|P21297|FLBT_CAUCR FLBT PROTEIN (141 letters) Database: data/swissprot 82,258 sequences; 29,652,561 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|120291|sp|P21297|FLBT_CAUCR FLBT PROTEIN 256 2e-68 gi|3024946|sp|Q58368|Y958_METJA HYPOTHETICAL PROTEIN MJ0958 PRE... 29 3.4 >gi|120291|sp|P21297|FLBT_CAUCR FLBT PROTEIN Length = 141 Score = 256 bits (646), Expect = 2e-68 Identities = 127/127 (100%), Positives = 127/127 (100%) Query: 1 MPLKLSLKPGEKFVLNGAVVQNGDRRGVLVLQNKASVLREKDIMQPDQVTTPARHIYFPV 60 MPLKLSLKPGEKFVLNGAVVQNGDRRGVLVLQNKASVLREKDIMQPDQVTTPARHIYFPV Sbjct: 1 MPLKLSLKPGEKFVLNGAVVQNGDRRGVLVLQNKASVLREKDIMQPDQVTTPARHIYFPV 60 Query: 61 MMMYLDEVGAEKFYEEFATRLNEFMGVVRNPVVLQDCIAISKHVMAREYYKALMLSRKLI 120 MMMYLDEVGAEKFYEEFATRLNEFMGVVRNPVVLQDCIAISKHVMAREYYKALMLSRKLI Sbjct: 61 MMMYLDEVGAEKFYEEFATRLNEFMGVVRNPVVLQDCIAISKHVMAREYYKALMLSRKLI 120 Query: 121 EYEDERL 127 EYEDERL Sbjct: 121 EYEDERL 127 >gi|3024946|sp|Q58368|Y958_METJA HYPOTHETICAL PROTEIN MJ0958 PRECURSOR Length = 426 Score = 29.3 bits (64), Expect = 3.4 Identities = 15/47 (31%), Positives = 23/47 (48%) Query: 28 VLVLQNKASVLREKDIMQPDQVTTPARHIYFPVMMMYLDEVGAEKFY 74 +LVL N ++ K D TT +IY P+ + + A+KFY Sbjct: 169 ILVLINNTNITELKKFEDDDYYTTFQHYIYQPIFIFTTYDSKAKKFY 215 Database: data/swissprot Posted date: Feb 2, 2000 9:39 AM Number of letters in database: 29,652,561 Number of sequences in database: 82,258 Lambda K H 0.323 0.139 0.392 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6932673 Number of Sequences: 82258 Number of extensions: 246623 Number of successful extensions: 486 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 484 Number of HSP's gapped (non-prelim): 2 length of query: 141 length of database: 29,652,561 effective HSP length: 50 effective length of query: 91 effective length of database: 25,539,661 effective search space: 2324109151 effective search space used: 2324109151 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 61 (28.2 bits)