BLASTX 2.2.20 [Feb-08-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|6273291|gb|AF191665.1|AF191665 Opuntia marenae rpl16 gene; chloroplast gene for chloroplast product, partial intron sequence (902 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 8,994,603 sequences; 3,078,807,967 total letters Searching..................................................done ***** No hits found ****** BLASTX 2.2.20 [Feb-08-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|6273290|gb|AF191664.1|AF191664 Opuntia clavata rpl16 gene; chloroplast gene for chloroplast product, partial intron sequence (899 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 8,994,603 sequences; 3,078,807,967 total letters Searching..................................................done ***** No hits found ****** BLASTX 2.2.20 [Feb-08-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|6273289|gb|AF191663.1|AF191663 Opuntia bradtiana rpl16 gene; chloroplast gene for chloroplast product, partial intron sequence (899 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 8,994,603 sequences; 3,078,807,967 total letters Searching..................................................done ***** No hits found ****** BLASTX 2.2.20 [Feb-08-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|6273287|gb|AF191661.1|AF191661 Opuntia kuehnrichiana rpl16 gene; chloroplast gene for chloroplast product, partial intron sequence (895 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 8,994,603 sequences; 3,078,807,967 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE48041.1| hypothetical protein [Nicotiana tomentosiformis] 51 8e-07 emb|CAJ32483.1| hypothetical protein [Nicotiana tabacum] >gi|777... 51 8e-07 >dbj|BAE48041.1| hypothetical protein [Nicotiana tomentosiformis] Length = 79 Score = 51.2 bits (121), Expect(2) = 8e-07 Identities = 25/40 (62%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = +2 Query: 290 MGTM*SMNTEDSIEKDP-MIHWEGWRNEPETNSSILKSDK 406 MGT +N +DSIEK MIHW GWRNEPE NS I +S+K Sbjct: 1 MGTTELVNAKDSIEKGILMIHWSGWRNEPEINSCIRRSEK 40 Score = 27.3 bits (59), Expect(2) = 8e-07 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 423 KIDIERVNIRPRKFLFFLNCSYF 491 +I IERVNIRPRK N + Sbjct: 48 EIGIERVNIRPRKLFLLQNLGQY 70 >emb|CAJ32483.1| hypothetical protein [Nicotiana tabacum] dbj|BAE46692.1| hypothetical protein [Nicotiana sylvestris] Length = 79 Score = 51.2 bits (121), Expect(2) = 8e-07 Identities = 25/40 (62%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = +2 Query: 290 MGTM*SMNTEDSIEKDP-MIHWEGWRNEPETNSSILKSDK 406 MGT +N +DSIEK MIHW GWRNEPE NS I +S+K Sbjct: 1 MGTTELVNAKDSIEKGILMIHWSGWRNEPEINSCIRRSEK 40 Score = 27.3 bits (59), Expect(2) = 8e-07 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 423 KIDIERVNIRPRKFLFFLNCSYF 491 +I IERVNIRPRK N + Sbjct: 48 EIGIERVNIRPRKLFLLQNLGQY 70 BLASTX 2.2.20 [Feb-08-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|6273286|gb|AF191660.1|AF191660 Opuntia echinacea rpl16 gene; chloroplast gene for chloroplast product, partial intron sequence (893 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 8,994,603 sequences; 3,078,807,967 total letters Searching..................................................done ***** No hits found ****** BLASTX 2.2.20 [Feb-08-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|6273285|gb|AF191659.1|AF191659 Opuntia pachypus rpl16 gene; chloroplast gene for chloroplast product, partial intron sequence (894 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 8,994,603 sequences; 3,078,807,967 total letters Searching..................................................done ***** No hits found ****** BLASTX 2.2.20 [Feb-08-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|6273284|gb|AF191658.1|AF191658 Opuntia subulata rpl16 gene; chloroplast gene for chloroplast product, partial intron sequence (896 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 8,994,603 sequences; 3,078,807,967 total letters Searching..................................................done ***** No hits found ****** Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jun 4, 2009 5:40 PM Number of letters in database: 3,078,807,967 Number of sequences in database: 8,994,603 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 8994603 Number of Hits to DB: 25,131,630,959 Number of extensions: 479411075 Number of successful extensions: 804218 Number of sequences better than 1.0e-04: 2 Number of HSP's gapped: 803721 Number of HSP's successfully gapped: 4 Length of database: 3,078,807,967 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)