# Copyright 2007-2010 by Peter Cock. All rights reserved. # Revisions copyright 2010 by Uri Laserson. All rights reserved. # This code is part of the Biopython distribution and governed by its # license. Please see the LICENSE file that should have been included # as part of this package. """Internal code for parsing GenBank and EMBL files (PRIVATE). This code is NOT intended for direct use. It provides a basic scanner (for use with a event consumer such as Bio.GenBank._FeatureConsumer) to parse a GenBank or EMBL file (with their shared INSDC feature table). It is used by Bio.GenBank to parse GenBank files It is also used by Bio.SeqIO to parse GenBank and EMBL files Feature Table Documentation: http://www.insdc.org/files/feature_table.html http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html ftp://ftp.ncbi.nih.gov/genbank/docs/ """ # 17-MAR-2009: added wgs, wgs_scafld for GenBank whole genome shotgun master records. # These are GenBank files that summarize the content of a project, and provide lists of # scaffold and contig files in the project. These will be in annotations['wgs'] and # annotations['wgs_scafld']. These GenBank files do not have sequences. See # http://groups.google.com/group/bionet.molbio.genbank/browse_thread/thread/51fb88bf39e7dc36 # http://is.gd/nNgk # for more details of this format, and an example. # Added by Ying Huang & Iddo Friedberg from __future__ import print_function import warnings import re from Bio.Seq import Seq from Bio.SeqRecord import SeqRecord from Bio.Alphabet import generic_protein from Bio import BiopythonParserWarning class InsdcScanner(object): """Basic functions for breaking up a GenBank/EMBL file into sub sections. The International Nucleotide Sequence Database Collaboration (INSDC) between the DDBJ, EMBL, and GenBank. These organisations all use the same "Feature Table" layout in their plain text flat file formats. However, the header and sequence sections of an EMBL file are very different in layout to those produced by GenBank/DDBJ.""" #These constants get redefined with sensible values in the sub classes: RECORD_START = "XXX" # "LOCUS " or "ID " HEADER_WIDTH = 3 # 12 or 5 FEATURE_START_MARKERS = ["XXX***FEATURES***XXX"] FEATURE_END_MARKERS = ["XXX***END FEATURES***XXX"] FEATURE_QUALIFIER_INDENT = 0 FEATURE_QUALIFIER_SPACER = "" SEQUENCE_HEADERS = ["XXX"] # with right hand side spaces removed def __init__(self, debug=0): assert len(self.RECORD_START) == self.HEADER_WIDTH for marker in self.SEQUENCE_HEADERS: assert marker == marker.rstrip() assert len(self.FEATURE_QUALIFIER_SPACER) == self.FEATURE_QUALIFIER_INDENT self.debug = debug self.line = None def set_handle(self, handle): self.handle = handle self.line = "" def find_start(self): """Read in lines until find the ID/LOCUS line, which is returned. Any preamble (such as the header used by the NCBI on *.seq.gz archives) will we ignored.""" while True: if self.line: line = self.line self.line = "" else: line = self.handle.readline() if not line: if self.debug: print("End of file") return None if line[:self.HEADER_WIDTH] == self.RECORD_START: if self.debug > 1: print("Found the start of a record:\n" + line) break line = line.rstrip() if line == "//": if self.debug > 1: print("Skipping // marking end of last record") elif line == "": if self.debug > 1: print("Skipping blank line before record") else: #Ignore any header before the first ID/LOCUS line. if self.debug > 1: print("Skipping header line before record:\n" + line) self.line = line return line def parse_header(self): """Return list of strings making up the header New line characters are removed. Assumes you have just read in the ID/LOCUS line. """ assert self.line[:self.HEADER_WIDTH] == self.RECORD_START, \ "Not at start of record" header_lines = [] while True: line = self.handle.readline() if not line: raise ValueError("Premature end of line during sequence data") line = line.rstrip() if line in self.FEATURE_START_MARKERS: if self.debug: print("Found feature table") break #if line[:self.HEADER_WIDTH]==self.FEATURE_START_MARKER[:self.HEADER_WIDTH]: # if self.debug : print("Found header table (?)") # break if line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS: if self.debug: print("Found start of sequence") break if line == "//": raise ValueError("Premature end of sequence data marker '//' found") header_lines.append(line) self.line = line return header_lines def parse_features(self, skip=False): """Return list of tuples for the features (if present) Each feature is returned as a tuple (key, location, qualifiers) where key and location are strings (e.g. "CDS" and "complement(join(490883..490885,1..879))") while qualifiers is a list of two string tuples (feature qualifier keys and values). Assumes you have already read to the start of the features table. """ if self.line.rstrip() not in self.FEATURE_START_MARKERS: if self.debug: print("Didn't find any feature table") return [] while self.line.rstrip() in self.FEATURE_START_MARKERS: self.line = self.handle.readline() features = [] line = self.line while True: if not line: raise ValueError("Premature end of line during features table") if line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS: if self.debug: print("Found start of sequence") break line = line.rstrip() if line == "//": raise ValueError("Premature end of features table, marker '//' found") if line in self.FEATURE_END_MARKERS: if self.debug: print("Found end of features") line = self.handle.readline() break if line[2:self.FEATURE_QUALIFIER_INDENT].strip() == "": #This is an empty feature line between qualifiers. Empty #feature lines within qualifiers are handled below (ignored). line = self.handle.readline() continue if len(line) < self.FEATURE_QUALIFIER_INDENT: warnings.warn("line too short to contain a feature: %r" % line, BiopythonParserWarning) line = self.handle.readline() continue if skip: line = self.handle.readline() while line[:self.FEATURE_QUALIFIER_INDENT] == self.FEATURE_QUALIFIER_SPACER: line = self.handle.readline() else: #Build up a list of the lines making up this feature: if line[self.FEATURE_QUALIFIER_INDENT] != " " \ and " " in line[self.FEATURE_QUALIFIER_INDENT:]: #The feature table design enforces a length limit on the feature keys. #Some third party files (e.g. IGMT's EMBL like files) solve this by #over indenting the location and qualifiers. feature_key, line = line[2:].strip().split(None, 1) feature_lines = [line] warnings.warn("Overindented %s feature?" % feature_key, BiopythonParserWarning) else: feature_key = line[2:self.FEATURE_QUALIFIER_INDENT].strip() feature_lines = [line[self.FEATURE_QUALIFIER_INDENT:]] line = self.handle.readline() while line[:self.FEATURE_QUALIFIER_INDENT] == self.FEATURE_QUALIFIER_SPACER \ or line.rstrip() == "": # cope with blank lines in the midst of a feature #Use strip to remove any harmless trailing white space AND and leading #white space (e.g. out of spec files with too much indentation) feature_lines.append(line[self.FEATURE_QUALIFIER_INDENT:].strip()) line = self.handle.readline() features.append(self.parse_feature(feature_key, feature_lines)) self.line = line return features def parse_feature(self, feature_key, lines): """Expects a feature as a list of strings, returns a tuple (key, location, qualifiers) For example given this GenBank feature: CDS complement(join(490883..490885,1..879)) /locus_tag="NEQ001" /note="conserved hypothetical [Methanococcus jannaschii]; COG1583:Uncharacterized ACR; IPR001472:Bipartite nuclear localization signal; IPR002743: Protein of unknown function DUF57" /codon_start=1 /transl_table=11 /product="hypothetical protein" /protein_id="NP_963295.1" /db_xref="GI:41614797" /db_xref="GeneID:2732620" /translation="MRLLLELKALNSIDKKQLSNYLIQGFIYNILKNTEYSWLHNWKK EKYFNFTLIPKKDIIENKRYYLIISSPDKRFIEVLHNKIKDLDIITIGLAQFQLRKTK KFDPKLRFPWVTITPIVLREGKIVILKGDKYYKVFVKRLEELKKYNLIKKKEPILEEP IEISLNQIKDGWKIIDVKDRYYDFRNKSFSAFSNWLRDLKEQSLRKYNNFCGKNFYFE EAIFEGFTFYKTVSIRIRINRGEAVYIGTLWKELNVYRKLDKEEREFYKFLYDCGLGS LNSMGFGFVNTKKNSAR" Then should give input key="CDS" and the rest of the data as a list of strings lines=["complement(join(490883..490885,1..879))", ..., "LNSMGFGFVNTKKNSAR"] where the leading spaces and trailing newlines have been removed. Returns tuple containing: (key as string, location string, qualifiers as list) as follows for this example: key = "CDS", string location = "complement(join(490883..490885,1..879))", string qualifiers = list of string tuples: [('locus_tag', '"NEQ001"'), ('note', '"conserved hypothetical [Methanococcus jannaschii];\nCOG1583:..."'), ('codon_start', '1'), ('transl_table', '11'), ('product', '"hypothetical protein"'), ('protein_id', '"NP_963295.1"'), ('db_xref', '"GI:41614797"'), ('db_xref', '"GeneID:2732620"'), ('translation', '"MRLLLELKALNSIDKKQLSNYLIQGFIYNILKNTEYSWLHNWKK\nEKYFNFT..."')] In the above example, the "note" and "translation" were edited for compactness, and they would contain multiple new line characters (displayed above as \n) If a qualifier is quoted (in this case, everything except codon_start and transl_table) then the quotes are NOT removed. Note that no whitespace is removed. """ #Skip any blank lines iterator = (x for x in lines if x) try: line = next(iterator) feature_location = line.strip() while feature_location[-1:] == ",": #Multiline location, still more to come! line = next(iterator) feature_location += line.strip() qualifiers = [] for line_number, line in enumerate(iterator): # check for extra wrapping of the location closing parentheses if line_number == 0 and line.startswith(")"): feature_location += line.strip() elif line[0] == "/": #New qualifier i = line.find("=") key = line[1:i] # does not work if i==-1 value = line[i + 1:] # we ignore 'value' if i==-1 if i == -1: #Qualifier with no key, e.g. /pseudo key = line[1:] qualifiers.append((key, None)) elif not value: #ApE can output /note= qualifiers.append((key, "")) elif value == '"': #One single quote if self.debug: print("Single quote %s:%s" % (key, value)) #DO NOT remove the quote... qualifiers.append((key, value)) elif value[0] == '"': #Quoted... value_list = [value] while value_list[-1][-1] != '"': value_list.append(next(iterator)) value = '\n'.join(value_list) #DO NOT remove the quotes... qualifiers.append((key, value)) else: #Unquoted #if debug : print("Unquoted line %s:%s" % (key,value)) qualifiers.append((key, value)) else: #Unquoted continuation assert len(qualifiers) > 0 assert key == qualifiers[-1][0] #if debug : print("Unquoted Cont %s:%s" % (key, line)) if qualifiers[-1][1] is None: raise StopIteration qualifiers[-1] = (key, qualifiers[-1][1] + "\n" + line) return (feature_key, feature_location, qualifiers) except StopIteration: #Bummer raise ValueError("Problem with '%s' feature:\n%s" % (feature_key, "\n".join(lines))) def parse_footer(self): """returns a tuple containing a list of any misc strings, and the sequence""" #This is a basic bit of code to scan and discard the sequence, #which was useful when developing the sub classes. if self.line in self.FEATURE_END_MARKERS: while self.line[:self.HEADER_WIDTH].rstrip() not in self.SEQUENCE_HEADERS: self.line = self.handle.readline() if not self.line: raise ValueError("Premature end of file") self.line = self.line.rstrip() assert self.line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS, \ "Not at start of sequence" while True: line = self.handle.readline() if not line: raise ValueError("Premature end of line during sequence data") line = line.rstrip() if line == "//": break self.line = line return ([], "") # Dummy values! def _feed_first_line(self, consumer, line): """Handle the LOCUS/ID line, passing data to the comsumer This should be implemented by the EMBL / GenBank specific subclass Used by the parse_records() and parse() methods. """ pass def _feed_header_lines(self, consumer, lines): """Handle the header lines (list of strings), passing data to the comsumer This should be implemented by the EMBL / GenBank specific subclass Used by the parse_records() and parse() methods. """ pass def _feed_feature_table(self, consumer, feature_tuples): """Handle the feature table (list of tuples), passing data to the comsumer Used by the parse_records() and parse() methods. """ consumer.start_feature_table() for feature_key, location_string, qualifiers in feature_tuples: consumer.feature_key(feature_key) consumer.location(location_string) for q_key, q_value in qualifiers: if q_value is None: consumer.feature_qualifier(q_key, q_value) else: consumer.feature_qualifier(q_key, q_value.replace("\n", " ")) def _feed_misc_lines(self, consumer, lines): """Handle any lines between features and sequence (list of strings), passing data to the consumer This should be implemented by the EMBL / GenBank specific subclass Used by the parse_records() and parse() methods. """ pass def feed(self, handle, consumer, do_features=True): """Feed a set of data into the consumer. This method is intended for use with the "old" code in Bio.GenBank Arguments: handle - A handle with the information to parse. consumer - The consumer that should be informed of events. do_features - Boolean, should the features be parsed? Skipping the features can be much faster. Return values: true - Passed a record false - Did not find a record """ #Should work with both EMBL and GenBank files provided the #equivalent Bio.GenBank._FeatureConsumer methods are called... self.set_handle(handle) if not self.find_start(): #Could not find (another) record consumer.data = None return False #We use the above class methods to parse the file into a simplified format. #The first line, header lines and any misc lines after the features will be #dealt with by GenBank / EMBL specific derived classes. #First line and header: self._feed_first_line(consumer, self.line) self._feed_header_lines(consumer, self.parse_header()) #Features (common to both EMBL and GenBank): if do_features: self._feed_feature_table(consumer, self.parse_features(skip=False)) else: self.parse_features(skip=True) # ignore the data #Footer and sequence misc_lines, sequence_string = self.parse_footer() self._feed_misc_lines(consumer, misc_lines) consumer.sequence(sequence_string) #Calls to consumer.base_number() do nothing anyway consumer.record_end("//") assert self.line == "//" #And we are done return True def parse(self, handle, do_features=True): """Returns a SeqRecord (with SeqFeatures if do_features=True) See also the method parse_records() for use on multi-record files. """ from Bio.GenBank import _FeatureConsumer from Bio.GenBank.utils import FeatureValueCleaner consumer = _FeatureConsumer(use_fuzziness=1, feature_cleaner=FeatureValueCleaner()) if self.feed(handle, consumer, do_features): return consumer.data else: return None def parse_records(self, handle, do_features=True): """Returns a SeqRecord object iterator Each record (from the ID/LOCUS line to the // line) becomes a SeqRecord The SeqRecord objects include SeqFeatures if do_features=True This method is intended for use in Bio.SeqIO """ #This is a generator function while True: record = self.parse(handle, do_features) if record is None: break if record.id is None: raise ValueError("Failed to parse the record's ID. Invalid ID line?") if record.name == "": raise ValueError("Failed to parse the record's name. Invalid ID line?") if record.description == "": raise ValueError("Failed to parse the record's description") yield record def parse_cds_features(self, handle, alphabet=generic_protein, tags2id=('protein_id', 'locus_tag', 'product')): """Returns SeqRecord object iterator Each CDS feature becomes a SeqRecord. alphabet - Used for any sequence found in a translation field. tags2id - Tupple of three strings, the feature keys to use for the record id, name and description, This method is intended for use in Bio.SeqIO """ self.set_handle(handle) while self.find_start(): #Got an EMBL or GenBank record... self.parse_header() # ignore header lines! feature_tuples = self.parse_features() #self.parse_footer() # ignore footer lines! while True: line = self.handle.readline() if not line: break if line[:2] == "//": break self.line = line.rstrip() #Now go though those features... for key, location_string, qualifiers in feature_tuples: if key == "CDS": #Create SeqRecord #================ #SeqRecord objects cannot be created with annotations, they #must be added afterwards. So create an empty record and #then populate it: record = SeqRecord(seq=None) annotations = record.annotations #Should we add a location object to the annotations? #I *think* that only makes sense for SeqFeatures with their #sub features... annotations['raw_location'] = location_string.replace(' ', '') for (qualifier_name, qualifier_data) in qualifiers: if qualifier_data is not None \ and qualifier_data[0] == '"' and qualifier_data[-1] == '"': #Remove quotes qualifier_data = qualifier_data[1:-1] #Append the data to the annotation qualifier... if qualifier_name == "translation": assert record.seq is None, "Multiple translations!" record.seq = Seq(qualifier_data.replace("\n", ""), alphabet) elif qualifier_name == "db_xref": #its a list, possibly empty. Its safe to extend record.dbxrefs.append(qualifier_data) else: if qualifier_data is not None: qualifier_data = qualifier_data.replace("\n", " ").replace(" ", " ") try: annotations[qualifier_name] += " " + qualifier_data except KeyError: #Not an addition to existing data, its the first bit annotations[qualifier_name] = qualifier_data #Fill in the ID, Name, Description #================================= try: record.id = annotations[tags2id[0]] except KeyError: pass try: record.name = annotations[tags2id[1]] except KeyError: pass try: record.description = annotations[tags2id[2]] except KeyError: pass yield record class EmblScanner(InsdcScanner): """For extracting chunks of information in EMBL files""" RECORD_START = "ID " HEADER_WIDTH = 5 FEATURE_START_MARKERS = ["FH Key Location/Qualifiers", "FH"] FEATURE_END_MARKERS = ["XX"] # XX can also mark the end of many things! FEATURE_QUALIFIER_INDENT = 21 FEATURE_QUALIFIER_SPACER = "FT" + " " * (FEATURE_QUALIFIER_INDENT - 2) SEQUENCE_HEADERS = ["SQ", "CO"] # Remove trailing spaces def parse_footer(self): """returns a tuple containing a list of any misc strings, and the sequence""" assert self.line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS, \ "Eh? '%s'" % self.line #Note that the SQ line can be split into several lines... misc_lines = [] while self.line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS: misc_lines.append(self.line) self.line = self.handle.readline() if not self.line: raise ValueError("Premature end of file") self.line = self.line.rstrip() assert self.line[:self.HEADER_WIDTH] == " " * self.HEADER_WIDTH \ or self.line.strip() == '//', repr(self.line) seq_lines = [] line = self.line while True: if not line: raise ValueError("Premature end of file in sequence data") line = line.strip() if not line: raise ValueError("Blank line in sequence data") if line == '//': break assert self.line[:self.HEADER_WIDTH] == " " * self.HEADER_WIDTH, \ repr(self.line) #Remove tailing number now, remove spaces later seq_lines.append(line.rsplit(None, 1)[0]) line = self.handle.readline() self.line = line return (misc_lines, "".join(seq_lines).replace(" ", "")) def _feed_first_line(self, consumer, line): assert line[:self.HEADER_WIDTH].rstrip() == "ID" if line[self.HEADER_WIDTH:].count(";") == 6: #Looks like the semi colon separated style introduced in 2006 self._feed_first_line_new(consumer, line) elif line[self.HEADER_WIDTH:].count(";") == 3: if line.rstrip().endswith(" SQ"): #EMBL-bank patent data self._feed_first_line_patents(consumer,line) else: #Looks like the pre 2006 style self._feed_first_line_old(consumer, line) else: raise ValueError('Did not recognise the ID line layout:\n' + line) def _feed_first_line_patents(self, consumer, line): #Either Non-Redundant Level 1 database records, #ID ; ; ; #e.g. ID NRP_AX000635; PRT; NR1; 15 SQ # #Or, Non-Redundant Level 2 database records: #ID ; ; ; #e.g. ID NRP0000016E; PRT; NR2; 5 SQ fields = line[self.HEADER_WIDTH:].rstrip()[:-3].split(";") assert len(fields) == 4 consumer.locus(fields[0]) consumer.residue_type(fields[1]) consumer.data_file_division(fields[2]) #TODO - Record cluster size? def _feed_first_line_old(self, consumer, line): #Expects an ID line in the style before 2006, e.g. #ID SC10H5 standard; DNA; PRO; 4870 BP. #ID BSUB9999 standard; circular DNA; PRO; 4214630 BP. assert line[:self.HEADER_WIDTH].rstrip() == "ID" fields = [line[self.HEADER_WIDTH:].split(None, 1)[0]] fields.extend(line[self.HEADER_WIDTH:].split(None, 1)[1].split(";")) fields = [entry.strip() for entry in fields] """ The tokens represent: 0. Primary accession number (space sep) 1. ??? (e.g. standard) (semi-colon) 2. Topology and/or Molecule type (e.g. 'circular DNA' or 'DNA') 3. Taxonomic division (e.g. 'PRO') 4. Sequence length (e.g. '4639675 BP.') """ consumer.locus(fields[0]) # Should we also call the accession consumer? consumer.residue_type(fields[2]) consumer.data_file_division(fields[3]) self._feed_seq_length(consumer, fields[4]) def _feed_first_line_new(self, consumer, line): #Expects an ID line in the style introduced in 2006, e.g. #ID X56734; SV 1; linear; mRNA; STD; PLN; 1859 BP. #ID CD789012; SV 4; linear; genomic DNA; HTG; MAM; 500 BP. assert line[:self.HEADER_WIDTH].rstrip() == "ID" fields = [data.strip() for data in line[self.HEADER_WIDTH:].strip().split(";")] assert len(fields) == 7 """ The tokens represent: 0. Primary accession number 1. Sequence version number 2. Topology: 'circular' or 'linear' 3. Molecule type (e.g. 'genomic DNA') 4. Data class (e.g. 'STD') 5. Taxonomic division (e.g. 'PRO') 6. Sequence length (e.g. '4639675 BP.') """ consumer.locus(fields[0]) #Call the accession consumer now, to make sure we record #something as the record.id, in case there is no AC line consumer.accession(fields[0]) #TODO - How to deal with the version field? At the moment the consumer #will try and use this for the ID which isn't ideal for EMBL files. version_parts = fields[1].split() if len(version_parts) == 2 \ and version_parts[0] == "SV" \ and version_parts[1].isdigit(): consumer.version_suffix(version_parts[1]) #Based on how the old GenBank parser worked, merge these two: consumer.residue_type(" ".join(fields[2:4])) # TODO - Store as two fields? #consumer.xxx(fields[4]) #TODO - What should we do with the data class? consumer.data_file_division(fields[5]) self._feed_seq_length(consumer, fields[6]) def _feed_seq_length(self, consumer, text): length_parts = text.split() assert len(length_parts) == 2, "Invalid sequence length string %r" % text assert length_parts[1].upper() in ["BP", "BP.", "AA", "AA."] consumer.size(length_parts[0]) def _feed_header_lines(self, consumer, lines): EMBL_INDENT = self.HEADER_WIDTH EMBL_SPACER = " " * EMBL_INDENT consumer_dict = { 'AC': 'accession', 'SV': 'version', # SV line removed in June 2006, now part of ID line 'DE': 'definition', #'RN' : 'reference_num', #'RC' : reference comment... TODO #'RP' : 'reference_bases', #'RX' : reference cross reference... DOI or Pubmed 'RG': 'consrtm', # optional consortium #'RA' : 'authors', #'RT' : 'title', 'RL': 'journal', 'OS': 'organism', 'OC': 'taxonomy', #'DR' : data reference 'CC': 'comment', #'XX' : splitter } #We have to handle the following specially: #RX (depending on reference type...) for line in lines: line_type = line[:EMBL_INDENT].strip() data = line[EMBL_INDENT:].strip() if line_type == 'XX': pass elif line_type == 'RN': # Reformat reference numbers for the GenBank based consumer # e.g. '[1]' becomes '1' if data[0] == "[" and data[-1] == "]": data = data[1:-1] consumer.reference_num(data) elif line_type == 'RP': # Reformat reference numbers for the GenBank based consumer # e.g. '1-4639675' becomes '(bases 1 to 4639675)' # and '160-550, 904-1055' becomes '(bases 160 to 550; 904 to 1055)' # Note could be multi-line, and end with a comma parts = [bases.replace("-", " to ").strip() for bases in data.split(",") if bases.strip()] consumer.reference_bases("(bases %s)" % "; ".join(parts)) elif line_type == 'RT': #Remove the enclosing quotes and trailing semi colon. #Note the title can be split over multiple lines. if data.startswith('"'): data = data[1:] if data.endswith('";'): data = data[:-2] consumer.title(data) elif line_type == 'RX': # EMBL support three reference types at the moment: # - PUBMED PUBMED bibliographic database (NLM) # - DOI Digital Object Identifier (International DOI Foundation) # - AGRICOLA US National Agriculture Library (NAL) of the US Department # of Agriculture (USDA) # # Format: # RX resource_identifier; identifier. # # e.g. # RX DOI; 10.1016/0024-3205(83)90010-3. # RX PUBMED; 264242. # # Currently our reference object only supports PUBMED and MEDLINE # (as these were in GenBank files?). key, value = data.split(";", 1) if value.endswith("."): value = value[:-1] value = value.strip() if key == "PUBMED": consumer.pubmed_id(value) #TODO - Handle other reference types (here and in BioSQL bindings) elif line_type == 'CC': # Have to pass a list of strings for this one (not just a string) consumer.comment([data]) elif line_type == 'DR': # Database Cross-reference, format: # DR database_identifier; primary_identifier; secondary_identifier. # # e.g. # DR MGI; 98599; Tcrb-V4. # # TODO - How should we store any secondary identifier? parts = data.rstrip(".").split(";") #Turn it into "database_identifier:primary_identifier" to #mimic the GenBank parser. e.g. "MGI:98599" consumer.dblink("%s:%s" % (parts[0].strip(), parts[1].strip())) elif line_type == 'RA': # Remove trailing ; at end of authors list consumer.authors(data.rstrip(";")) elif line_type == 'PR': # Remove trailing ; at end of the project reference # In GenBank files this corresponds to the old PROJECT # line which is being replaced with the DBLINK line. consumer.project(data.rstrip(";")) elif line_type == 'KW': consumer.keywords(data.rstrip(";")) elif line_type in consumer_dict: #Its a semi-automatic entry! getattr(consumer, consumer_dict[line_type])(data) else: if self.debug: print("Ignoring EMBL header line:\n%s" % line) def _feed_misc_lines(self, consumer, lines): #TODO - Should we do something with the information on the SQ line(s)? lines.append("") line_iter = iter(lines) try: for line in line_iter: if line.startswith("CO "): line = line[5:].strip() contig_location = line while True: line = next(line_iter) if not line: break elif line.startswith("CO "): #Don't need to preseve the whitespace here. contig_location += line[5:].strip() else: raise ValueError('Expected CO (contig) continuation line, got:\n' + line) consumer.contig_location(contig_location) if line.startswith("SQ Sequence "): #e.g. #SQ Sequence 219 BP; 82 A; 48 C; 33 G; 45 T; 11 other; # #Or, EMBL-bank patent, e.g. #SQ Sequence 465 AA; 3963407aa91d3a0d622fec679a4524e0; MD5; self._feed_seq_length(consumer, line[14:].rstrip().rstrip(";").split(";", 1)[0]) #TODO - Record the checksum etc? return except StopIteration: raise ValueError("Problem in misc lines before sequence") class _ImgtScanner(EmblScanner): """For extracting chunks of information in IMGT (EMBL like) files (PRIVATE). IMGT files are like EMBL files but in order to allow longer feature types the features should be indented by 25 characters not 21 characters. In practice the IMGT flat files tend to use either 21 or 25 characters, so we must cope with both. This is private to encourage use of Bio.SeqIO rather than Bio.GenBank. """ FEATURE_START_MARKERS = ["FH Key Location/Qualifiers", "FH Key Location/Qualifiers (from EMBL)", "FH Key Location/Qualifiers", "FH"] def parse_features(self, skip=False): """Return list of tuples for the features (if present) Each feature is returned as a tuple (key, location, qualifiers) where key and location are strings (e.g. "CDS" and "complement(join(490883..490885,1..879))") while qualifiers is a list of two string tuples (feature qualifier keys and values). Assumes you have already read to the start of the features table. """ if self.line.rstrip() not in self.FEATURE_START_MARKERS: if self.debug: print("Didn't find any feature table") return [] while self.line.rstrip() in self.FEATURE_START_MARKERS: self.line = self.handle.readline() bad_position_re = re.compile(r'([0-9]+)>{1}') features = [] line = self.line while True: if not line: raise ValueError("Premature end of line during features table") if line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS: if self.debug: print("Found start of sequence") break line = line.rstrip() if line == "//": raise ValueError("Premature end of features table, marker '//' found") if line in self.FEATURE_END_MARKERS: if self.debug: print("Found end of features") line = self.handle.readline() break if line[2:self.FEATURE_QUALIFIER_INDENT].strip() == "": #This is an empty feature line between qualifiers. Empty #feature lines within qualifiers are handled below (ignored). line = self.handle.readline() continue if skip: line = self.handle.readline() while line[:self.FEATURE_QUALIFIER_INDENT] == self.FEATURE_QUALIFIER_SPACER: line = self.handle.readline() else: assert line[:2] == "FT" try: feature_key, location_start = line[2:].strip().split() except ValueError: #e.g. "FT TRANSMEMBRANE-REGION2163..2240\n" #Assume indent of 25 as per IMGT spec, with the location #start in column 26 (one-based). feature_key = line[2:25].strip() location_start = line[25:].strip() feature_lines = [location_start] line = self.handle.readline() while line[:self.FEATURE_QUALIFIER_INDENT] == self.FEATURE_QUALIFIER_SPACER \ or line.rstrip() == "": # cope with blank lines in the midst of a feature #Use strip to remove any harmless trailing white space AND and leading #white space (copes with 21 or 26 indents and orther variants) assert line[:2] == "FT" feature_lines.append(line[self.FEATURE_QUALIFIER_INDENT:].strip()) line = self.handle.readline() feature_key, location, qualifiers = \ self.parse_feature(feature_key, feature_lines) #Try to handle known problems with IMGT locations here: if ">" in location: #Nasty hack for common IMGT bug, should be >123 not 123> #in a location string. At least here the meaning is clear, #and since it is so common I don't want to issue a warning #warnings.warn("Feature location %s is invalid, " # "moving greater than sign before position" # % location, BiopythonParserWarning) location = bad_position_re.sub(r'>\1', location) features.append((feature_key, location, qualifiers)) self.line = line return features class GenBankScanner(InsdcScanner): """For extracting chunks of information in GenBank files""" RECORD_START = "LOCUS " HEADER_WIDTH = 12 FEATURE_START_MARKERS = ["FEATURES Location/Qualifiers", "FEATURES"] FEATURE_END_MARKERS = [] FEATURE_QUALIFIER_INDENT = 21 FEATURE_QUALIFIER_SPACER = " " * FEATURE_QUALIFIER_INDENT SEQUENCE_HEADERS = ["CONTIG", "ORIGIN", "BASE COUNT", "WGS"] # trailing spaces removed def parse_footer(self): """returns a tuple containing a list of any misc strings, and the sequence""" assert self.line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS, \ "Eh? '%s'" % self.line misc_lines = [] while self.line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS \ or self.line[:self.HEADER_WIDTH] == " " * self.HEADER_WIDTH \ or "WGS" == self.line[:3]: misc_lines.append(self.line.rstrip()) self.line = self.handle.readline() if not self.line: raise ValueError("Premature end of file") self.line = self.line assert self.line[:self.HEADER_WIDTH].rstrip() not in self.SEQUENCE_HEADERS, \ "Eh? '%s'" % self.line #Now just consume the sequence lines until reach the // marker #or a CONTIG line seq_lines = [] line = self.line while True: if not line: warnings.warn("Premature end of file in sequence data", BiopythonParserWarning) line = '//' break line = line.rstrip() if not line: warnings.warn("Blank line in sequence data", BiopythonParserWarning) line = self.handle.readline() continue if line == '//': break if line.startswith('CONTIG'): break if len(line) > 9 and line[9:10] != ' ': # Some broken programs indent the sequence by one space too many # so try to get rid of that and test again. warnings.warn("Invalid indentation for sequence line", BiopythonParserWarning) line = line[1:] if len(line) > 9 and line[9:10] != ' ': raise ValueError("Sequence line mal-formed, '%s'" % line) seq_lines.append(line[10:]) # remove spaces later line = self.handle.readline() self.line = line #Seq("".join(seq_lines), self.alphabet) return (misc_lines, "".join(seq_lines).replace(" ", "")) def _feed_first_line(self, consumer, line): """Scan over and parse GenBank LOCUS line (PRIVATE). This must cope with several variants, primarily the old and new column based standards from GenBank. Additionally EnsEMBL produces GenBank files where the LOCUS line is space separated rather that following the column based layout. We also try to cope with GenBank like files with partial LOCUS lines. """ ##################################### # LOCUS line # ##################################### GENBANK_INDENT = self.HEADER_WIDTH GENBANK_SPACER = " " * GENBANK_INDENT assert line[0:GENBANK_INDENT] == 'LOCUS ', \ 'LOCUS line does not start correctly:\n' + line #Have to break up the locus line, and handle the different bits of it. #There are at least two different versions of the locus line... if line[29:33] in [' bp ', ' aa ', ' rc '] and line[55:62] == ' ': #Old... note we insist on the 55:62 being empty to avoid trying #to parse space separated LOCUS lines from Ensembl etc, see below. # # Positions Contents # --------- -------- # 00:06 LOCUS # 06:12 spaces # 12:?? Locus name # ??:?? space # ??:29 Length of sequence, right-justified # 29:33 space, bp, space # 33:41 strand type # 41:42 space # 42:51 Blank (implies linear), linear or circular # 51:52 space # 52:55 The division code (e.g. BCT, VRL, INV) # 55:62 space # 62:73 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991) # #assert line[29:33] in [' bp ', ' aa ',' rc '] , \ # 'LOCUS line does not contain size units at expected position:\n' + line assert line[41:42] == ' ', \ 'LOCUS line does not contain space at position 42:\n' + line assert line[42:51].strip() in ['', 'linear', 'circular'], \ 'LOCUS line does not contain valid entry (linear, circular, ...):\n' + line assert line[51:52] == ' ', \ 'LOCUS line does not contain space at position 52:\n' + line #assert line[55:62] == ' ', \ # 'LOCUS line does not contain spaces from position 56 to 62:\n' + line if line[62:73].strip(): assert line[64:65] == '-', \ 'LOCUS line does not contain - at position 65 in date:\n' + line assert line[68:69] == '-', \ 'LOCUS line does not contain - at position 69 in date:\n' + line name_and_length_str = line[GENBANK_INDENT:29] while ' ' in name_and_length_str: name_and_length_str = name_and_length_str.replace(' ', ' ') name_and_length = name_and_length_str.split(' ') assert len(name_and_length) <= 2, \ 'Cannot parse the name and length in the LOCUS line:\n' + line assert len(name_and_length) != 1, \ 'Name and length collide in the LOCUS line:\n' + line #Should be possible to split them based on position, if #a clear definition of the standard exists THAT AGREES with #existing files. consumer.locus(name_and_length[0]) consumer.size(name_and_length[1]) #consumer.residue_type(line[33:41].strip()) if line[33:51].strip() == "" and line[29:33] == ' aa ': #Amino acids -> protein (even if there is no residue type given) #We want to use a protein alphabet in this case, rather than a #generic one. Not sure if this is the best way to achieve this, #but it works because the scanner checks for this: consumer.residue_type("PROTEIN") else: consumer.residue_type(line[33:51].strip()) consumer.data_file_division(line[52:55]) if line[62:73].strip(): consumer.date(line[62:73]) elif line[40:44] in [' bp ', ' aa ', ' rc '] \ and line[54:64].strip() in ['', 'linear', 'circular']: #New... linear/circular/big blank test should avoid EnsEMBL style #LOCUS line being treated like a proper column based LOCUS line. # # Positions Contents # --------- -------- # 00:06 LOCUS # 06:12 spaces # 12:?? Locus name # ??:?? space # ??:40 Length of sequence, right-justified # 40:44 space, bp, space # 44:47 Blank, ss-, ds-, ms- # 47:54 Blank, DNA, RNA, tRNA, mRNA, uRNA, snRNA, cDNA # 54:55 space # 55:63 Blank (implies linear), linear or circular # 63:64 space # 64:67 The division code (e.g. BCT, VRL, INV) # 67:68 space # 68:79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991) # assert line[40:44] in [' bp ', ' aa ', ' rc '], \ 'LOCUS line does not contain size units at expected position:\n' + line assert line[44:47] in [' ', 'ss-', 'ds-', 'ms-'], \ 'LOCUS line does not have valid strand type (Single stranded, ...):\n' + line assert line[47:54].strip() == "" \ or 'DNA' in line[47:54].strip().upper() \ or 'RNA' in line[47:54].strip().upper(), \ 'LOCUS line does not contain valid sequence type (DNA, RNA, ...):\n' + line assert line[54:55] == ' ', \ 'LOCUS line does not contain space at position 55:\n' + line assert line[55:63].strip() in ['', 'linear', 'circular'], \ 'LOCUS line does not contain valid entry (linear, circular, ...):\n' + line assert line[63:64] == ' ', \ 'LOCUS line does not contain space at position 64:\n' + line assert line[67:68] == ' ', \ 'LOCUS line does not contain space at position 68:\n' + line if line[68:79].strip(): assert line[70:71] == '-', \ 'LOCUS line does not contain - at position 71 in date:\n' + line assert line[74:75] == '-', \ 'LOCUS line does not contain - at position 75 in date:\n' + line name_and_length_str = line[GENBANK_INDENT:40] while ' ' in name_and_length_str: name_and_length_str = name_and_length_str.replace(' ', ' ') name_and_length = name_and_length_str.split(' ') assert len(name_and_length) <= 2, \ 'Cannot parse the name and length in the LOCUS line:\n' + line assert len(name_and_length) != 1, \ 'Name and length collide in the LOCUS line:\n' + line #Should be possible to split them based on position, if #a clear definition of the stand exists THAT AGREES with #existing files. consumer.locus(name_and_length[0]) consumer.size(name_and_length[1]) if line[44:54].strip() == "" and line[40:44] == ' aa ': #Amino acids -> protein (even if there is no residue type given) #We want to use a protein alphabet in this case, rather than a #generic one. Not sure if this is the best way to achieve this, #but it works because the scanner checks for this: consumer.residue_type(("PROTEIN " + line[54:63]).strip()) else: consumer.residue_type(line[44:63].strip()) consumer.data_file_division(line[64:67]) if line[68:79].strip(): consumer.date(line[68:79]) elif line[GENBANK_INDENT:].strip().count(" ") == 0: #Truncated LOCUS line, as produced by some EMBOSS tools - see bug 1762 # #e.g. # # "LOCUS U00096" # #rather than: # # "LOCUS U00096 4639675 bp DNA circular BCT" # # Positions Contents # --------- -------- # 00:06 LOCUS # 06:12 spaces # 12:?? Locus name if line[GENBANK_INDENT:].strip() != "": consumer.locus(line[GENBANK_INDENT:].strip()) else: #Must just have just "LOCUS ", is this even legitimate? #We should be able to continue parsing... we need real world testcases! warnings.warn("Minimal LOCUS line found - is this " "correct?\n:%r" % line, BiopythonParserWarning) elif len(line.split()) == 8 and line.split()[3] in ("aa", "bp") and \ line.split()[5] in ('linear', 'circular'): # Cope with invalidly spaced GenBank LOCUS lines like #LOCUS AB070938 6497 bp DNA linear BCT 11-OCT-2001 splitline = line.split() consumer.locus(splitline[1]) consumer.size(splitline[2]) consumer.residue_type(splitline[4]) consumer.data_file_division(splitline[6]) consumer.date(splitline[7]) warnings.warn("Attempting to parse malformed locus line:\n%r\n" "Found locus %r size %r residue_type %r\n" "Some fields may be wrong." % (line, splitline[1], splitline[2], splitline[4]), BiopythonParserWarning) elif len(line.split()) == 7 and line.split()[3] in ["aa", "bp"]: #Cope with EnsEMBL genbank files which use space separation rather #than the expected column based layout. e.g. #LOCUS HG531_PATCH 1000000 bp DNA HTG 18-JUN-2011 #LOCUS HG531_PATCH 759984 bp DNA HTG 18-JUN-2011 #LOCUS HG506_HG1000_1_PATCH 814959 bp DNA HTG 18-JUN-2011 #LOCUS HG506_HG1000_1_PATCH 1219964 bp DNA HTG 18-JUN-2011 #Notice that the 'bp' can occur in the position expected by either #the old or the new fixed column standards (parsed above). splitline = line.split() consumer.locus(splitline[1]) consumer.size(splitline[2]) consumer.residue_type(splitline[4]) consumer.data_file_division(splitline[5]) consumer.date(splitline[6]) elif len(line.split()) >= 4 and line.split()[3] in ["aa", "bp"]: #Cope with EMBOSS seqret output where it seems the locus id can cause #the other fields to overflow. We just IGNORE the other fields! warnings.warn("Malformed LOCUS line found - is this " "correct?\n:%r" % line, BiopythonParserWarning) consumer.locus(line.split()[1]) consumer.size(line.split()[2]) elif len(line.split()) >= 4 and line.split()[-1] in ["aa", "bp"]: #Cope with pseudo-GenBank files like this: # "LOCUS RNA5 complete 1718 bp" #Treat everything between LOCUS and the size as the identifier. warnings.warn("Malformed LOCUS line found - is this " "correct?\n:%r" % line, BiopythonParserWarning) consumer.locus(line[5:].rsplit(None, 2)[0].strip()) consumer.size(line.split()[-2]) else: raise ValueError('Did not recognise the LOCUS line layout:\n' + line) def _feed_header_lines(self, consumer, lines): #Following dictionary maps GenBank lines to the associated #consumer methods - the special cases like LOCUS where one #genbank line triggers several consumer calls have to be #handled individually. GENBANK_INDENT = self.HEADER_WIDTH GENBANK_SPACER = " " * GENBANK_INDENT consumer_dict = { 'DEFINITION': 'definition', 'ACCESSION': 'accession', 'NID': 'nid', 'PID': 'pid', 'DBSOURCE': 'db_source', 'KEYWORDS': 'keywords', 'SEGMENT': 'segment', 'SOURCE': 'source', 'AUTHORS': 'authors', 'CONSRTM': 'consrtm', 'PROJECT': 'project', 'DBLINK': 'dblink', 'TITLE': 'title', 'JOURNAL': 'journal', 'MEDLINE': 'medline_id', 'PUBMED': 'pubmed_id', 'REMARK': 'remark'} #We have to handle the following specially: #ORIGIN (locus, size, residue_type, data_file_division and date) #COMMENT (comment) #VERSION (version and gi) #REFERENCE (eference_num and reference_bases) #ORGANISM (organism and taxonomy) lines = [_f for _f in lines if _f] lines.append("") # helps avoid getting StopIteration all the time line_iter = iter(lines) try: line = next(line_iter) while True: if not line: break line_type = line[:GENBANK_INDENT].strip() data = line[GENBANK_INDENT:].strip() if line_type == 'VERSION': #Need to call consumer.version(), and maybe also consumer.gi() as well. #e.g. # VERSION AC007323.5 GI:6587720 while ' ' in data: data = data.replace(' ', ' ') if ' GI:' not in data: consumer.version(data) else: if self.debug: print("Version [" + data.split(' GI:')[0] + "], gi [" + data.split(' GI:')[1] + "]") consumer.version(data.split(' GI:')[0]) consumer.gi(data.split(' GI:')[1]) #Read in the next line! line = next(line_iter) elif line_type == 'REFERENCE': if self.debug > 1: print("Found reference [" + data + "]") #Need to call consumer.reference_num() and consumer.reference_bases() #e.g. # REFERENCE 1 (bases 1 to 86436) # #Note that this can be multiline, see Bug 1968, e.g. # # REFERENCE 42 (bases 1517 to 1696; 3932 to 4112; 17880 to 17975; 21142 to # 28259) # #For such cases we will call the consumer once only. data = data.strip() #Read in the next line, and see if its more of the reference: while True: line = next(line_iter) if line[:GENBANK_INDENT] == GENBANK_SPACER: #Add this continuation to the data string data += " " + line[GENBANK_INDENT:] if self.debug > 1: print("Extended reference text [" + data + "]") else: #End of the reference, leave this text in the variable "line" break #We now have all the reference line(s) stored in a string, data, #which we pass to the consumer while ' ' in data: data = data.replace(' ', ' ') if ' ' not in data: if self.debug > 2: print('Reference number \"' + data + '\"') consumer.reference_num(data) else: if self.debug > 2: print('Reference number \"' + data[:data.find(' ')] + '\", \"' + data[data.find(' ') + 1:] + '\"') consumer.reference_num(data[:data.find(' ')]) consumer.reference_bases(data[data.find(' ') + 1:]) elif line_type == 'ORGANISM': #Typically the first line is the organism, and subsequent lines #are the taxonomy lineage. However, given longer and longer #species names (as more and more strains and sub strains get #sequenced) the oragnism name can now get wrapped onto multiple #lines. The NCBI say we have to recognise the lineage line by #the presence of semi-colon delimited entries. In the long term, #they are considering adding a new keyword (e.g. LINEAGE). #See Bug 2591 for details. organism_data = data lineage_data = "" while True: line = next(line_iter) if line[0:GENBANK_INDENT] == GENBANK_SPACER: if lineage_data or ";" in line: lineage_data += " " + line[GENBANK_INDENT:] else: organism_data += " " + line[GENBANK_INDENT:].strip() else: #End of organism and taxonomy break consumer.organism(organism_data) if lineage_data.strip() == "" and self.debug > 1: print("Taxonomy line(s) missing or blank") consumer.taxonomy(lineage_data.strip()) del organism_data, lineage_data elif line_type == 'COMMENT': if self.debug > 1: print("Found comment") #This can be multiline, and should call consumer.comment() once #with a list where each entry is a line. comment_list = [] comment_list.append(data) while True: line = next(line_iter) if line[0:GENBANK_INDENT] == GENBANK_SPACER: data = line[GENBANK_INDENT:] comment_list.append(data) if self.debug > 2: print("Comment continuation [" + data + "]") else: #End of the comment break consumer.comment(comment_list) del comment_list elif line_type in consumer_dict: #Its a semi-automatic entry! #Now, this may be a multi line entry... while True: line = next(line_iter) if line[0:GENBANK_INDENT] == GENBANK_SPACER: data += ' ' + line[GENBANK_INDENT:] else: #We now have all the data for this entry: getattr(consumer, consumer_dict[line_type])(data) #End of continuation - return to top of loop! break else: if self.debug: print("Ignoring GenBank header line:\n" % line) #Read in next line line = next(line_iter) except StopIteration: raise ValueError("Problem in header") def _feed_misc_lines(self, consumer, lines): #Deals with a few misc lines between the features and the sequence GENBANK_INDENT = self.HEADER_WIDTH GENBANK_SPACER = " " * GENBANK_INDENT lines.append("") line_iter = iter(lines) try: for line in line_iter: if line.startswith('BASE COUNT'): line = line[10:].strip() if line: if self.debug: print("base_count = " + line) consumer.base_count(line) if line.startswith('ORIGIN'): line = line[6:].strip() if line: if self.debug: print("origin_name = " + line) consumer.origin_name(line) if line.startswith('WGS '): line = line[3:].strip() consumer.wgs(line) if line.startswith('WGS_SCAFLD'): line = line[10:].strip() consumer.add_wgs_scafld(line) if line.startswith('CONTIG'): line = line[6:].strip() contig_location = line while True: line = next(line_iter) if not line: break elif line[:GENBANK_INDENT] == GENBANK_SPACER: #Don't need to preseve the whitespace here. contig_location += line[GENBANK_INDENT:].rstrip() elif line.startswith('ORIGIN'): #Strange, seen this in GenPept files via Entrez gbwithparts line = line[6:].strip() if line: consumer.origin_name(line) break else: raise ValueError('Expected CONTIG continuation line, got:\n' + line) consumer.contig_location(contig_location) return except StopIteration: raise ValueError("Problem in misc lines before sequence") if __name__ == "__main__": from Bio._py3k import StringIO gbk_example = \ """LOCUS SCU49845 5028 bp DNA PLN 21-JUN-1999 DEFINITION Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl2p (AXL2) and Rev7p (REV7) genes, complete cds. ACCESSION U49845 VERSION U49845.1 GI:1293613 KEYWORDS . SOURCE Saccharomyces cerevisiae (baker's yeast) ORGANISM Saccharomyces cerevisiae Eukaryota; Fungi; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 5028) AUTHORS Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W. TITLE Cloning and sequence of REV7, a gene whose function is required for DNA damage-induced mutagenesis in Saccharomyces cerevisiae JOURNAL Yeast 10 (11), 1503-1509 (1994) PUBMED 7871890 REFERENCE 2 (bases 1 to 5028) AUTHORS Roemer,T., Madden,K., Chang,J. and Snyder,M. TITLE Selection of axial growth sites in yeast requires Axl2p, a novel plasma membrane glycoprotein JOURNAL Genes Dev. 10 (7), 777-793 (1996) PUBMED 8846915 REFERENCE 3 (bases 1 to 5028) AUTHORS Roemer,T. TITLE Direct Submission JOURNAL Submitted (22-FEB-1996) Terry Roemer, Biology, Yale University, New Haven, CT, USA FEATURES Location/Qualifiers source 1..5028 /organism="Saccharomyces cerevisiae" /db_xref="taxon:4932" /chromosome="IX" /map="9" CDS <1..206 /codon_start=3 /product="TCP1-beta" /protein_id="AAA98665.1" /db_xref="GI:1293614" /translation="SSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEA AEVLLRVDNIIRARPRTANRQHM" gene 687..3158 /gene="AXL2" CDS 687..3158 /gene="AXL2" /note="plasma membrane glycoprotein" /codon_start=1 /function="required for axial budding pattern of S. cerevisiae" /product="Axl2p" /protein_id="AAA98666.1" /db_xref="GI:1293615" /translation="MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESF TFQISNDTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLYFN VILEGTDSADSTSLNNTYQFVVTNRPSISLSSDFNLLALLKNYGYTNGKNALKLDPNE VFNVTFDRSMFTNEESIVSYYGRSQLYNAPLPNWLFFDSGELKFTGTAPVINSAIAPE TSYSFVIIATDIEGFSAVEVEFELVIGAHQLTTSIQNSLIINVTDTGNVSYDLPLNYV YLDDDPISSDKLGSINLLDAPDWVALDNATISGSVPDELLGKNSNPANFSVSIYDTYG DVIYFNFEVVSTTDLFAISSLPNINATRGEWFSYYFLPSQFTDYVNTNVSLEFTNSSQ DHDWVKFQSSNLTLAGEVPKNFDKLSLGLKANQGSQSQELYFNIIGMDSKITHSNHSA NATSTRSSHHSTSTSSYTSSTYTAKISSTSAAATSSAPAALPAANKTSSHNKKAVAIA CGVAIPLGVILVALICFLIFWRRRRENPDDENLPHAISGPDLNNPANKPNQENATPLN NPFDDDASSYDDTSIARRLAALNTLKLDNHSATESDISSVDEKRDSLSGMNTYNDQFQ SQSKEELLAKPPVQPPESPFFDPQNRSSSVYMDSEPAVNKSWRYTGNLSPVSDIVRDS YGSQKTVDTEKLFDLEAPEKEKRTSRDVTMSSLDPWNSNISPSPVRKSVTPSPYNVTK HRNRHLQNIQDSQSGKNGITPTTMSTSSSDDFVPVKDGENFCWVHSMEPDRRPSKKRL VDFSNKSNVNVGQVKDIHGRIPEML" gene complement(3300..4037) /gene="REV7" CDS complement(3300..4037) /gene="REV7" /codon_start=1 /product="Rev7p" /protein_id="AAA98667.1" /db_xref="GI:1293616" /translation="MNRWVEKWLRVYLKCYINLILFYRNVYPPQSFDYTTYQSFNLPQ FVPINRHPALIDYIEELILDVLSKLTHVYRFSICIINKKNDLCIEKYVLDFSELQHVD KDDQIITETEVFDEFRSSLNSLIMHLEKLPKVNDDTITFEAVINAIELELGHKLDRNR RVDSLEEKAEIERDSNWVKCQEDENLPDNNGFQPPKIKLTSLVGSDVGPLIIHQFSEK LISGDDKILNGVYSQYEEGESIFGSLF" ORIGIN 1 gatcctccat atacaacggt atctccacct caggtttaga tctcaacaac ggaaccattg 61 ccgacatgag acagttaggt atcgtcgaga gttacaagct aaaacgagca gtagtcagct 121 ctgcatctga agccgctgaa gttctactaa gggtggataa catcatccgt gcaagaccaa 181 gaaccgccaa tagacaacat atgtaacata tttaggatat acctcgaaaa taataaaccg 241 ccacactgtc attattataa ttagaaacag aacgcaaaaa ttatccacta tataattcaa 301 agacgcgaaa aaaaaagaac aacgcgtcat agaacttttg gcaattcgcg tcacaaataa 361 attttggcaa cttatgtttc ctcttcgagc agtactcgag ccctgtctca agaatgtaat 421 aatacccatc gtaggtatgg ttaaagatag catctccaca acctcaaagc tccttgccga 481 gagtcgccct cctttgtcga gtaattttca cttttcatat gagaacttat tttcttattc 541 tttactctca catcctgtag tgattgacac tgcaacagcc accatcacta gaagaacaga 601 acaattactt aatagaaaaa ttatatcttc ctcgaaacga tttcctgctt ccaacatcta 661 cgtatatcaa gaagcattca cttaccatga cacagcttca gatttcatta ttgctgacag 721 ctactatatc actactccat ctagtagtgg ccacgcccta tgaggcatat cctatcggaa 781 aacaataccc cccagtggca agagtcaatg aatcgtttac atttcaaatt tccaatgata 841 cctataaatc gtctgtagac aagacagctc aaataacata caattgcttc gacttaccga 901 gctggctttc gtttgactct agttctagaa cgttctcagg tgaaccttct tctgacttac 961 tatctgatgc gaacaccacg ttgtatttca atgtaatact cgagggtacg gactctgccg 1021 acagcacgtc tttgaacaat acataccaat ttgttgttac aaaccgtcca tccatctcgc 1081 tatcgtcaga tttcaatcta ttggcgttgt taaaaaacta tggttatact aacggcaaaa 1141 acgctctgaa actagatcct aatgaagtct tcaacgtgac ttttgaccgt tcaatgttca 1201 ctaacgaaga atccattgtg tcgtattacg gacgttctca gttgtataat gcgccgttac 1261 ccaattggct gttcttcgat tctggcgagt tgaagtttac tgggacggca ccggtgataa 1321 actcggcgat tgctccagaa acaagctaca gttttgtcat catcgctaca gacattgaag 1381 gattttctgc cgttgaggta gaattcgaat tagtcatcgg ggctcaccag ttaactacct 1441 ctattcaaaa tagtttgata atcaacgtta ctgacacagg taacgtttca tatgacttac 1501 ctctaaacta tgtttatctc gatgacgatc ctatttcttc tgataaattg ggttctataa 1561 acttattgga tgctccagac tgggtggcat tagataatgc taccatttcc gggtctgtcc 1621 cagatgaatt actcggtaag aactccaatc ctgccaattt ttctgtgtcc atttatgata 1681 cttatggtga tgtgatttat ttcaacttcg aagttgtctc cacaacggat ttgtttgcca 1741 ttagttctct tcccaatatt aacgctacaa ggggtgaatg gttctcctac tattttttgc 1801 cttctcagtt tacagactac gtgaatacaa acgtttcatt agagtttact aattcaagcc 1861 aagaccatga ctgggtgaaa ttccaatcat ctaatttaac attagctgga gaagtgccca 1921 agaatttcga caagctttca ttaggtttga aagcgaacca aggttcacaa tctcaagagc 1981 tatattttaa catcattggc atggattcaa agataactca ctcaaaccac agtgcgaatg 2041 caacgtccac aagaagttct caccactcca cctcaacaag ttcttacaca tcttctactt 2101 acactgcaaa aatttcttct acctccgctg ctgctacttc ttctgctcca gcagcgctgc 2161 cagcagccaa taaaacttca tctcacaata aaaaagcagt agcaattgcg tgcggtgttg 2221 ctatcccatt aggcgttatc ctagtagctc tcatttgctt cctaatattc tggagacgca 2281 gaagggaaaa tccagacgat gaaaacttac cgcatgctat tagtggacct gatttgaata 2341 atcctgcaaa taaaccaaat caagaaaacg ctacaccttt gaacaacccc tttgatgatg 2401 atgcttcctc gtacgatgat acttcaatag caagaagatt ggctgctttg aacactttga 2461 aattggataa ccactctgcc actgaatctg atatttccag cgtggatgaa aagagagatt 2521 ctctatcagg tatgaataca tacaatgatc agttccaatc ccaaagtaaa gaagaattat 2581 tagcaaaacc cccagtacag cctccagaga gcccgttctt tgacccacag aataggtctt 2641 cttctgtgta tatggatagt gaaccagcag taaataaatc ctggcgatat actggcaacc 2701 tgtcaccagt ctctgatatt gtcagagaca gttacggatc acaaaaaact gttgatacag 2761 aaaaactttt cgatttagaa gcaccagaga aggaaaaacg tacgtcaagg gatgtcacta 2821 tgtcttcact ggacccttgg aacagcaata ttagcccttc tcccgtaaga aaatcagtaa 2881 caccatcacc atataacgta acgaagcatc gtaaccgcca cttacaaaat attcaagact 2941 ctcaaagcgg taaaaacgga atcactccca caacaatgtc aacttcatct tctgacgatt 3001 ttgttccggt taaagatggt gaaaattttt gctgggtcca tagcatggaa ccagacagaa 3061 gaccaagtaa gaaaaggtta gtagattttt caaataagag taatgtcaat gttggtcaag 3121 ttaaggacat tcacggacgc atcccagaaa tgctgtgatt atacgcaacg atattttgct 3181 taattttatt ttcctgtttt attttttatt agtggtttac agatacccta tattttattt 3241 agtttttata cttagagaca tttaatttta attccattct tcaaatttca tttttgcact 3301 taaaacaaag atccaaaaat gctctcgccc tcttcatatt gagaatacac tccattcaaa 3361 attttgtcgt caccgctgat taatttttca ctaaactgat gaataatcaa aggccccacg 3421 tcagaaccga ctaaagaagt gagttttatt ttaggaggtt gaaaaccatt attgtctggt 3481 aaattttcat cttcttgaca tttaacccag tttgaatccc tttcaatttc tgctttttcc 3541 tccaaactat cgaccctcct gtttctgtcc aacttatgtc ctagttccaa ttcgatcgca 3601 ttaataactg cttcaaatgt tattgtgtca tcgttgactt taggtaattt ctccaaatgc 3661 ataatcaaac tatttaagga agatcggaat tcgtcgaaca cttcagtttc cgtaatgatc 3721 tgatcgtctt tatccacatg ttgtaattca ctaaaatcta aaacgtattt ttcaatgcat 3781 aaatcgttct ttttattaat aatgcagatg gaaaatctgt aaacgtgcgt taatttagaa 3841 agaacatcca gtataagttc ttctatatag tcaattaaag caggatgcct attaatggga 3901 acgaactgcg gcaagttgaa tgactggtaa gtagtgtagt cgaatgactg aggtgggtat 3961 acatttctat aaaataaaat caaattaatg tagcatttta agtataccct cagccacttc 4021 tctacccatc tattcataaa gctgacgcaa cgattactat tttttttttc ttcttggatc 4081 tcagtcgtcg caaaaacgta taccttcttt ttccgacctt ttttttagct ttctggaaaa 4141 gtttatatta gttaaacagg gtctagtctt agtgtgaaag ctagtggttt cgattgactg 4201 atattaagaa agtggaaatt aaattagtag tgtagacgta tatgcatatg tatttctcgc 4261 ctgtttatgt ttctacgtac ttttgattta tagcaagggg aaaagaaata catactattt 4321 tttggtaaag gtgaaagcat aatgtaaaag ctagaataaa atggacgaaa taaagagagg 4381 cttagttcat cttttttcca aaaagcaccc aatgataata actaaaatga aaaggatttg 4441 ccatctgtca gcaacatcag ttgtgtgagc aataataaaa tcatcacctc cgttgccttt 4501 agcgcgtttg tcgtttgtat cttccgtaat tttagtctta tcaatgggaa tcataaattt 4561 tccaatgaat tagcaatttc gtccaattct ttttgagctt cttcatattt gctttggaat 4621 tcttcgcact tcttttccca ttcatctctt tcttcttcca aagcaacgat ccttctaccc 4681 atttgctcag agttcaaatc ggcctctttc agtttatcca ttgcttcctt cagtttggct 4741 tcactgtctt ctagctgttg ttctagatcc tggtttttct tggtgtagtt ctcattatta 4801 gatctcaagt tattggagtc ttcagccaat tgctttgtat cagacaattg actctctaac 4861 ttctccactt cactgtcgag ttgctcgttt ttagcggaca aagatttaat ctcgttttct 4921 ttttcagtgt tagattgctc taattctttg agctgttctc tcagctcctc atatttttct 4981 tgccatgact cagattctaa ttttaagcta ttcaatttct ctttgatc //""" # GenBank format protein (aka GenPept) file from: # http://www.molecularevolution.org/resources/fileformats/ gbk_example2 = \ """LOCUS AAD51968 143 aa linear BCT 21-AUG-2001 DEFINITION transcriptional regulator RovA [Yersinia enterocolitica]. ACCESSION AAD51968 VERSION AAD51968.1 GI:5805369 DBSOURCE locus AF171097 accession AF171097.1 KEYWORDS . SOURCE Yersinia enterocolitica ORGANISM Yersinia enterocolitica Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Yersinia. REFERENCE 1 (residues 1 to 143) AUTHORS Revell,P.A. and Miller,V.L. TITLE A chromosomally encoded regulator is required for expression of the Yersinia enterocolitica inv gene and for virulence JOURNAL Mol. Microbiol. 35 (3), 677-685 (2000) MEDLINE 20138369 PUBMED 10672189 REFERENCE 2 (residues 1 to 143) AUTHORS Revell,P.A. and Miller,V.L. TITLE Direct Submission JOURNAL Submitted (22-JUL-1999) Molecular Microbiology, Washington University School of Medicine, Campus Box 8230, 660 South Euclid, St. Louis, MO 63110, USA COMMENT Method: conceptual translation. FEATURES Location/Qualifiers source 1..143 /organism="Yersinia enterocolitica" /mol_type="unassigned DNA" /strain="JB580v" /serotype="O:8" /db_xref="taxon:630" Protein 1..143 /product="transcriptional regulator RovA" /name="regulates inv expression" CDS 1..143 /gene="rovA" /coded_by="AF171097.1:380..811" /note="regulator of virulence" /transl_table=11 ORIGIN 1 mestlgsdla rlvrvwrali dhrlkplelt qthwvtlhni nrlppeqsqi qlakaigieq 61 pslvrtldql eekglitrht candrrakri klteqsspii eqvdgvicst rkeilggisp 121 deiellsgli dklerniiql qsk // """ embl_example = """ID X56734; SV 1; linear; mRNA; STD; PLN; 1859 BP. XX AC X56734; S46826; XX DT 12-SEP-1991 (Rel. 29, Created) DT 25-NOV-2005 (Rel. 85, Last updated, Version 11) XX DE Trifolium repens mRNA for non-cyanogenic beta-glucosidase XX KW beta-glucosidase. XX OS Trifolium repens (white clover) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; OC eurosids I; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium. XX RN [5] RP 1-1859 RX PUBMED; 1907511. RA Oxtoby E., Dunn M.A., Pancoro A., Hughes M.A.; RT "Nucleotide and derived amino acid sequence of the cyanogenic RT beta-glucosidase (linamarase) from white clover (Trifolium repens L.)"; RL Plant Mol. Biol. 17(2):209-219(1991). XX RN [6] RP 1-1859 RA Hughes M.A.; RT ; RL Submitted (19-NOV-1990) to the EMBL/GenBank/DDBJ databases. RL Hughes M.A., University of Newcastle Upon Tyne, Medical School, Newcastle RL Upon Tyne, NE2 4HH, UK XX FH Key Location/Qualifiers FH FT source 1..1859 FT /organism="Trifolium repens" FT /mol_type="mRNA" FT /clone_lib="lambda gt10" FT /clone="TRE361" FT /tissue_type="leaves" FT /db_xref="taxon:3899" FT CDS 14..1495 FT /product="beta-glucosidase" FT /EC_number="3.2.1.21" FT /note="non-cyanogenic" FT /db_xref="GOA:P26204" FT /db_xref="InterPro:IPR001360" FT /db_xref="InterPro:IPR013781" FT /db_xref="UniProtKB/Swiss-Prot:P26204" FT /protein_id="CAA40058.1" FT /translation="MDFIVAIFALFVISSFTITSTNAVEASTLLDIGNLSRSSFPRGFI FT FGAGSSAYQFEGAVNEGGRGPSIWDTFTHKYPEKIRDGSNADITVDQYHRYKEDVGIMK FT DQNMDSYRFSISWPRILPKGKLSGGINHEGIKYYNNLINELLANGIQPFVTLFHWDLPQ FT VLEDEYGGFLNSGVINDFRDYTDLCFKEFGDRVRYWSTLNEPWVFSNSGYALGTNAPGR FT CSASNVAKPGDSGTGPYIVTHNQILAHAEAVHVYKTKYQAYQKGKIGITLVSNWLMPLD FT DNSIPDIKAAERSLDFQFGLFMEQLTTGDYSKSMRRIVKNRLPKFSKFESSLVNGSFDF FT IGINYYSSSYISNAPSHGNAKPSYSTNPMTNISFEKHGIPLGPRAASIWIYVYPYMFIQ FT EDFEIFCYILKINITILQFSITENGMNEFNDATLPVEEALLNTYRIDYYYRHLYYIRSA FT IRAGSNVKGFYAWSFLDCNEWFAGFTVRFGLNFVD" FT mRNA 1..1859 FT /experiment="experimental evidence, no additional details FT recorded" XX SQ Sequence 1859 BP; 609 A; 314 C; 355 G; 581 T; 0 other; aaacaaacca aatatggatt ttattgtagc catatttgct ctgtttgtta ttagctcatt 60 cacaattact tccacaaatg cagttgaagc ttctactctt cttgacatag gtaacctgag 120 tcggagcagt tttcctcgtg gcttcatctt tggtgctgga tcttcagcat accaatttga 180 aggtgcagta aacgaaggcg gtagaggacc aagtatttgg gataccttca cccataaata 240 tccagaaaaa ataagggatg gaagcaatgc agacatcacg gttgaccaat atcaccgcta 300 caaggaagat gttgggatta tgaaggatca aaatatggat tcgtatagat tctcaatctc 360 ttggccaaga atactcccaa agggaaagtt gagcggaggc ataaatcacg aaggaatcaa 420 atattacaac aaccttatca acgaactatt ggctaacggt atacaaccat ttgtaactct 480 ttttcattgg gatcttcccc aagtcttaga agatgagtat ggtggtttct taaactccgg 540 tgtaataaat gattttcgag actatacgga tctttgcttc aaggaatttg gagatagagt 600 gaggtattgg agtactctaa atgagccatg ggtgtttagc aattctggat atgcactagg 660 aacaaatgca ccaggtcgat gttcggcctc caacgtggcc aagcctggtg attctggaac 720 aggaccttat atagttacac acaatcaaat tcttgctcat gcagaagctg tacatgtgta 780 taagactaaa taccaggcat atcaaaaggg aaagataggc ataacgttgg tatctaactg 840 gttaatgcca cttgatgata atagcatacc agatataaag gctgccgaga gatcacttga 900 cttccaattt ggattgttta tggaacaatt aacaacagga gattattcta agagcatgcg 960 gcgtatagtt aaaaaccgat tacctaagtt ctcaaaattc gaatcaagcc tagtgaatgg 1020 ttcatttgat tttattggta taaactatta ctcttctagt tatattagca atgccccttc 1080 acatggcaat gccaaaccca gttactcaac aaatcctatg accaatattt catttgaaaa 1140 acatgggata cccttaggtc caagggctgc ttcaatttgg atatatgttt atccatatat 1200 gtttatccaa gaggacttcg agatcttttg ttacatatta aaaataaata taacaatcct 1260 gcaattttca atcactgaaa atggtatgaa tgaattcaac gatgcaacac ttccagtaga 1320 agaagctctt ttgaatactt acagaattga ttactattac cgtcacttat actacattcg 1380 ttctgcaatc agggctggct caaatgtgaa gggtttttac gcatggtcat ttttggactg 1440 taatgaatgg tttgcaggct ttactgttcg ttttggatta aactttgtag attagaaaga 1500 tggattaaaa aggtacccta agctttctgc ccaatggtac aagaactttc tcaaaagaaa 1560 ctagctagta ttattaaaag aactttgtag tagattacag tacatcgttt gaagttgagt 1620 tggtgcacct aattaaataa aagaggttac tcttaacata tttttaggcc attcgttgtg 1680 aagttgttag gctgttattt ctattatact atgttgtagt aataagtgca ttgttgtacc 1740 agaagctatg atcataacta taggttgatc cttcatgtat cagtttgatg ttgagaatac 1800 tttgaattaa aagtcttttt ttattttttt aaaaaaaaaa aaaaaaaaaa aaaaaaaaa 1859 // """ print("GenBank CDS Iteration") print("=====================") g = GenBankScanner() for record in g.parse_cds_features(StringIO(gbk_example)): print(record) g = GenBankScanner() for record in g.parse_cds_features(StringIO(gbk_example2), tags2id=('gene', 'locus_tag', 'product')): print(record) g = GenBankScanner() for record in g.parse_cds_features(StringIO(gbk_example + "\n" + gbk_example2), tags2id=('gene', 'locus_tag', 'product')): print(record) print("") print("GenBank Iteration") print("=================") g = GenBankScanner() for record in g.parse_records(StringIO(gbk_example), do_features=False): print("%s %s %s" % (record.id, record.name, record.description)) print(record.seq) g = GenBankScanner() for record in g.parse_records(StringIO(gbk_example), do_features=True): print("%s %s %s" % (record.id, record.name, record.description)) print(record.seq) g = GenBankScanner() for record in g.parse_records(StringIO(gbk_example2), do_features=False): print("%s %s %s" % (record.id, record.name, record.description)) print(record.seq) g = GenBankScanner() for record in g.parse_records(StringIO(gbk_example2), do_features=True): print("%s %s %s" % (record.id, record.name, record.description)) print(record.seq) print("") print("EMBL CDS Iteration") print("==================") e = EmblScanner() for record in e.parse_cds_features(StringIO(embl_example)): print(record) print("") print("EMBL Iteration") print("==============") e = EmblScanner() for record in e.parse_records(StringIO(embl_example), do_features=True): print("%s %s %s" % (record.id, record.name, record.description)) print(record.seq)