# Genetic Code Table
#
# Obtained from: http://www3.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi
#
#  Version 3.6
#     Added code 22 TAG-Leu, TCA-stop
#        found in mitochondrial DNA of Scenedesmus obliquus
#        submitted by Gertraude Berger, Ph.D.
#        Organelle Genome Megasequencing Program, Univ Montreal
#
# Other Alternative Initiation Codons
#
# GUG, UUG (and possibly CUG) in the Archaea (Noelling et al., unpublished) 
# AUA, GUG, UUG, and AUC or AAG may be used (at least in experimental
# systems) by the yeasts Saccharomyces cerevisiae (Olsen, 1987, and references
# therein). 
#
# ACG initiates translation of certain proteins in the adeno-associated virus
# type 2 (Becerra et al., 1985), the phage T7 mutant CR17 (Anderson and
# Buzash-Pollert, 1985), Sendai virus (Gupta and Patwardhan, 1988), and rice
# chloroplast (Hiratsuka et al., 1989). Also, it is the most effective non-AUG
# initiation codon in mammalin cells (Koepke and Leggatt, 1991). 
#
# CUG is the initiation codon for one of the two alternative products of the
# human c-myc gene (Hann et al., 1987). 
#
# Systematic Range:
#
# Scenedesmus obliquus: Nedelcu A, Lee RW, Lemieux C, Gray MW and Burger G.
# "The complete mitochondrial DNA sequence of Scenedesmus obliquus reflects an
# intermediate stage in the evolution of the green algal mitochondrial genome."
# Genome Research (in press). 

Genetic Code [22]

Scenedesmus obliquus Mitochondrial

AAs  =   FFLLSS*SYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
Base1  = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
Base2  = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
Base3  = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG