LOCUS       PEACAB15                 822 bp    mRNA    linear   PLN 27-APR-1993
DEFINITION  Pea major chlorophyll a/b-binding thylakoid protein (polypeptide
            15) mRNA, clone pAB96.
ACCESSION   J01253
VERSION     J01253.1  GI:169050
KEYWORDS    chlorophyll-binding protein; major chlorophyll binding protein;
            polypeptide 15.
SOURCE      Pisum sativum (pea)
  ORGANISM  Pisum sativum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons;
            rosids; eurosids I; Fabales; Fabaceae; Papilionoideae; Vicieae;
            Pisum.
REFERENCE   1  (bases 1 to 822)
  AUTHORS   Coruzzi,G., Broglie,R., Cashmore,A. and Chua,N.H.
  TITLE     Nucleotide sequences of two pea cDNA clones encoding the small
            subunit of ribulose 1,5-bisphosphate carboxylase and the major
            chlorophyll a/b-binding thylakoid polypeptide
  JOURNAL   J. Biol. Chem. 258 (3), 1399-1402 (1983)
   PUBMED   6296093
COMMENT     Original source text: Pea, cDNA to mRNA, clone pAB96.
            The mRNA encoding polypeptide 15 of the light-harvesting
            chlorophyll a/b-protein complex is translated on free cytoplasmic
            polysomes as a larger precursor, which is imported
            post-translationally into chloroplasts by an ATP-dependent process.
            The precursor chain extension (transit sequence) is thought to
            function in the post-translational translocation across the
            chloroplast envelope.
            [1] also reported the cDNA clone pSS15 (separate entry) which
            encodes the small subunit of ribulose 1,5-bisphosphate carboxylase.
FEATURES             Location/Qualifiers
     source          1..822
                     /organism="Pisum sativum"
                     /mol_type="mRNA"
                     /db_xref="taxon:3888"
     mRNA            <1..822
                     /product="polypeptide 15 mRNA"
     CDS             <1..688
                     /note="polypeptide 15 precursor"
                     /codon_start=2
                     /protein_id="AAA33650.1"
                     /db_xref="GI:169051"
                     /translation="TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDT
                     AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS
                     EGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPL
                     GLAEVPEAFAELKVKELKNGRLAMFSMFGFFVPAIVTGKGPLENLADHLADPVNNNAW
                     SYATNFVPGK"
     mat_peptide     <1..685
                     /product="polypeptide 15"
ORIGIN      59 bp upstream of RsaI site.
        1 caccaccaag aaagtagcct cctctagtag cccatggcac ggcccagacg gtgttaagta
       61 cctaggccca ttctccggtg agtctccatc atacttgacc ggagagttcc caggtgacta
      121 cggttgggac actgctggac tttctgccga tccagagaca tttgccaaga accgtgagct
      181 tgaagttatc cactccagat gggctatgtt gggagccttg ggatgtgtct tcccagagct
      241 tttgtctcgc aacggtgtta aattcggtga agctgtatgg ttcaaggcag gatctcaaat
      301 ctttagcgag ggtggacttg actacttggg caacccaagc ttggtccatg ctcaaagcat
      361 ccttgccatc tgggccactc aggttatctt gatgggagct gttgaaggtt accgtattgc
      421 cggtggccct cttggtgagg ttgttgaccc actttatcct ggtggtagct ttgatccatt
      481 aggcttagct gaagtaccag aagcttttgc agaattaaag gtaaaggaac tgaagaacgg
      541 tagattagcc atgttctcta tgtttggttt ctttgttcca gctattgtaa ctggaaaggg
      601 tcctttggag aaccttgccg atcatcttgc cgacccagtg aacaacaacg catggtcata
      661 tgctaccaac tttgttcccg gaaagtgaac actattatgt ttatgttatt ggtgaagtat
      721 gttattgtta ttgtaatgtt cttccaattt aatgtgaatt gttatggtta tcgtgtgtgt
      781 atgcgtaggt taactaatat gaactgattc gttttttttt tc
//