LOCUS       NZ_ACVX01000095          926 bp    DNA     linear   CON 10-NOV-2010
DEFINITION  Clostridium thermocellum DSM 2360 ctg00144, whole genome shotgun
            sequence.
ACCESSION   NZ_ACVX01000095 NZ_ACVX00000000
VERSION     NZ_ACVX01000095.1  GI:256006212
KEYWORDS    WGS.
SOURCE      Clostridium thermocellum DSM 2360
  ORGANISM  Clostridium thermocellum DSM 2360
            Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
            Clostridium.
COMMENT     PREDICTED REFSEQ: This record has not been reviewed and the
            function is unknown. The reference sequence was derived from
            ACVX01000095.
FEATURES             Location/Qualifiers
     source          1..926
                     /organism="Clostridium thermocellum DSM 2360"
                     /mol_type="genomic DNA"
                     /strain="DSM 2360"
                     /isolation_source="contaminant of Clostridium thermocellum
                     strain LQ8"
                     /db_xref="taxon:572545"
     gene            complement(99..344)
                     /locus_tag="ClothDRAFT_2976"
     CDS             complement(99..344)
                     /locus_tag="ClothDRAFT_2976"
                     /inference="protein motif:PFAM:PF08708"
                     /note="PFAM: Primase 1;
                     KEGG: aeh:Mlg_0791 ATPase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Primase 1"
                     /protein_id="ZP_05431111.1"
                     /db_xref="GI:256006213"
                     /db_xref="InterPro:IPR014820"
                     /translation="MEREEVLLTPFEGSSIIVEIKEGSRNSTLTSLAGTMRARGMTEE
                     GIYTALLAENNARCNPPLDEAEVKKIYSLGFQRVSNL"
     misc_feature    complement(105..290)
                     /locus_tag="ClothDRAFT_2976"
                     /note="Primase C terminal 1 (PriCT-1); Region: PriCT_1;
                     pfam08708"
                     /db_xref="CDD:149687"
     gene            complement(455..904)
                     /locus_tag="ClothDRAFT_2977"
     CDS             complement(455..904)
                     /locus_tag="ClothDRAFT_2977"
                     /inference="protein motif:PFAM:PF09250"
                     /note="PFAM: Bifunctional DNA primase/polymerase;
                     KEGG: dol:Dole_2704 bifunctional DNA primase/polymerase"
                     /codon_start=1
                     /transl_table=11
                     /product="Bifunctional DNA primase/polymerase"
                     /protein_id="ZP_05431112.1"
                     /db_xref="GI:256006214"
                     /db_xref="InterPro:IPR015330"
                     /translation="MKVTMMDAALKYAEANIPVIPLHWICEGGLCSCKAGSNCDSRGK
                     RPLYTGWYKNSTTDVKQINKWWRKSPNANIGITTGEKSGWLALDVDMVAMKPYLHLKQ
                     HMENFLIRLLLLPAEEVGTMSLNTHKAGVFQIRPSLHRILIRVQQMA"
     misc_feature    complement(<635..790)
                     /locus_tag="ClothDRAFT_2977"
                     /note="Prim_Pol: Primase-polymerase (primpol) domain of
                     the type found in bifunctional replicases from archaeal
                     plasmids, including ORF904 protein of the crenarchaeal
                     plasmid pRN1 from Sulfolobus islandicus (pRN1 primpol).
                     These primpol domains belong to the...; Region: Prim_Pol;
                     cd04859"
                     /db_xref="CDD:80309"
     misc_feature    complement(order(635..637,641..643,773..775))
                     /locus_tag="ClothDRAFT_2977"
                     /note="polymerase nucleotide-binding site; other site"
                     /db_xref="CDD:80309"
     misc_feature    complement(order(758..760,770..772))
                     /locus_tag="ClothDRAFT_2977"
                     /note="DNA-binding residues; DNA binding site"
                     /db_xref="CDD:80309"
     misc_feature    complement(order(635..637,641..643))
                     /locus_tag="ClothDRAFT_2977"
                     /note="primase nucleotide-binding site; other site"
                     /db_xref="CDD:80309"
ORIGIN      
        1 gctgaattat tcaggcaata cgtaaatact ttatgactgt acaaagctcc tctgcaaaaa
       61 tcaagtggct ttgtgcgtat atcgtatata ttaattcttt acaagttact aactctttga
      121 aaacctaaac tatatatttt cttaacttcc gcttcatcaa gcggaggatt gcaccttgcg
      181 ttgttttctg caagtaatgc cgtatagatg ccttcctccg tcattcctct tgctctcatg
      241 gttcctgcaa ggcttgtcag ggtgctgttt cggctgcctt ccttaatctc gactataata
      301 ctgctacctt caaagggtgt aagcaatact tcctcccttt ccataagctt taatagccac
      361 tccggagctt ctgccggggt tctgtcaaag ggagaatgtc cttccaacca ttggtactga
      421 ttaccactta catgaatgct tggagctacg acaatcaggc catctgttga acgcgtatca
      481 agatccggtg caaacttggt cttatttgga atactcctgc cttgtgggta tttaaagaca
      541 tagtgccgac ctcctctgcc ggtaacagca gtaaccgtat cagaaaattt tccatgtgtt
      601 gcttcaagtg cagatatggt ttcattgcca ccatgtccac atcaagcgcc agccagccgg
      661 acttttcgcc tgtagtaatg cctatattgg cattggggct ttttctccac catttgttta
      721 tttgcttaac atcagtagtg gaattcttgt accagcctgt atataacgga cgctttcccc
      781 tgctgtcgca attactccct gccttgcagg agcataagcc accctcacaa atccagtgca
      841 gaggtataac cgggatattg gcttctgcat attttaatgc cgcgtccatc attgtcactt
      901 tcaaatttcc acctcctccg agaaca
//