TBLASTN 2.5.0+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.



Database: Nucleotide collection (nt)
           39,204,206 sequences; 128,339,311,604 total letters



Query= 
Length=83
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KF410865.1  Triticum aestivum cultivar MB105 defensin gene, compl...  132     1e-38
KJ551528.1  Triticum aestivum cultivar Chinese Spring defensin (P...  132     7e-37
AB089942.1  Triticum aestivum Tad1 mRNA for defensin, complete cds    132     9e-37
AK358090.1  Hordeum vulgare subsp. vulgare mRNA for predicted pro...  121     4e-33
BT009107.1  Triticum aestivum clone wkm2n.pk009.f17:fis, full ins...  119     7e-32
KJ551523.1  Triticum aestivum cultivar Chinese Spring defensin (P...  119     9e-32
KJ551517.1  Triticum aestivum cultivar Chinese Spring defensin (P...  116     3e-31
BT009554.1  Triticum aestivum clone wre1.pk0001.d8:fis, full inse...  115     1e-30
JQ435849.1  Triticum aestivum cultivar Falat defensin precursor, ...  111     1e-30
KJ551525.1  Triticum aestivum cultivar Chinese Spring defensin (P...  115     2e-30
BT009066.1  Triticum aestivum clone wem1c.pk001.k1:fis, full inse...  106     8e-27
KJ551529.1  Triticum aestivum cultivar Chinese Spring defensin (P...  101     1e-25
KJ551524.1  Triticum aestivum cultivar Chinese Spring defensin (P...  102     3e-25
BT009231.1  Triticum aestivum clone wle1n.pk0096.f4:fis, full ins...  101     5e-25
BT008925.1  Triticum aestivum clone waw1c.pk005.e22:fis, full ins...  101     6e-25
KJ551519.1  Triticum aestivum cultivar Chinese Spring defensin (P...  101     7e-25
FP098065.1  Phyllostachys edulis cDNA clone: bphyst012p01, full i...  98.6    3e-24
XM_006647489.2  PREDICTED: Oryza brachyantha defensin Tm-AMP-D1.2...  100     4e-24
GQ449372.1  Triticum aestivum defensin precursor (PRPI) mRNA, com...  99.0    7e-24
AK436613.1  Brachypodium distachyon mRNA, clone: PL016C01-A-080_J14   97.4    7e-24
KJ551516.1  Triticum aestivum cultivar Chinese Spring defensin (P...  99.0    7e-24
FP101274.1  Phyllostachys edulis cDNA clone: bphylf002b05, full i...  98.2    1e-23
AK434755.1  Brachypodium distachyon mRNA, clone: PL016C01-A-068_A05   97.1    1e-23
AK430986.1  Brachypodium distachyon mRNA, clone: PL016C01-A-043_N19   97.1    1e-23
FP093864.1  Phyllostachys edulis cDNA clone: bphyst002e09, full i...  98.2    1e-23
FP099650.1  Phyllostachys edulis cDNA clone: bbasst002l03, full i...  97.8    1e-23
BT009100.1  Triticum aestivum clone wkm2n.pk003.d23:fis, full ins...  97.8    2e-23
AK426421.1  Brachypodium distachyon mRNA, clone: PL016C01-A-014_E18   97.1    2e-23
AK434997.1  Brachypodium distachyon mRNA, clone: PL016C01-A-069_J11   97.1    2e-23
AK432974.1  Brachypodium distachyon mRNA, clone: PL016C01-A-056_M09   97.1    2e-23
AK428189.1  Brachypodium distachyon mRNA, clone: PL016C01-A-025_L03   97.1    2e-23
AK436080.1  Brachypodium distachyon mRNA, clone: PL016C01-A-077_C12   97.1    2e-23
AK431842.1  Brachypodium distachyon mRNA, clone: PL016C01-A-049_G10   97.1    2e-23
XM_003575364.3  PREDICTED: Brachypodium distachyon defensin Tm-AM...  97.1    3e-23
AK250623.1  Hordeum vulgare subsp. vulgare cDNA clone: FLbaf87f13...  97.4    4e-23
BT008931.1  Triticum aestivum clone wde2f.pk001.g2:fis, full inse...  95.5    5e-23
KJ551522.1  Triticum aestivum cultivar Chinese Spring defensin (P...  96.3    1e-22
GQ449377.1  Triticum turgidum subsp. durum defensin precursor (PR...  99.8    1e-22
FP093414.1  Phyllostachys edulis cDNA clone: bphyst019l07, full i...  96.7    2e-22
AK424742.1  Brachypodium distachyon mRNA, clone: PL016C01-A-004_A17   94.7    3e-22
EF558101.1  Oryza sativa (indica cultivar-group) clone N22B_5F.z1...  89.4    8e-22
FP094058.1  Phyllostachys edulis cDNA clone: bphylf039j16, full i...  96.7    9e-22
XM_002446756.1  Sorghum bicolor hypothetical protein, mRNA            89.0    1e-21
BT009073.1  Triticum aestivum clone wip1c.pk002.f10:fis, full ins...  92.4    2e-21
LN650981.1  Zea mays mRNA for Defensin protein (Defensin gene), c...  89.0    2e-21
AK250501.1  Hordeum vulgare subsp. vulgare cDNA clone: FLbaf83i03...  92.8    2e-21
KJ551521.1  Triticum aestivum cultivar Chinese Spring defensin (P...  92.4    2e-21
AK354890.1  Hordeum vulgare subsp. vulgare mRNA for predicted pro...  89.7    6e-21
HG792392.1  Zea mays subsp. mays mRNA for defensin (def1 gene), c...  87.0    8e-21
EF200066.1  Setaria italica defensin mRNA, complete cds               87.0    8e-21
EU293126.1  Triticum aestivum isolate AI-1 amylase inhibitor-like...  89.7    8e-21
KJ551527.1  Triticum aestivum cultivar Chinese Spring defensin (P...  89.4    2e-20
EU531731.1  Saccharum officinarum defensin precursor (PDEF) mRNA,...  85.9    2e-20
KJ551520.1  Triticum aestivum cultivar Chinese Spring defensin (P...  89.7    2e-20
KU575117.1  Saccharum hybrid cultivar CoC 671 defensin 1 (Def1) m...  85.5    3e-20
BT009007.1  Triticum aestivum clone wdk2c.pk019.h18:fis, full ins...  89.7    3e-20
AK332803.1  Triticum aestivum cDNA, clone: SET1_O13, cultivar: Ch...  89.4    3e-20
EU293127.1  Triticum aestivum isolate AI-2 amylase inhibitor-like...  88.6    3e-20
LN878139.1  Zea mays defensin gene for mRNA_DEF, cultivar LVN99       85.9    3e-20
LN650980.1  Zea mays mRNA for Defensin protein (Defensin gene), c...  85.5    4e-20
EF557689.1  Oryza sativa (indica cultivar-group) clone IR62266_5F...  85.5    4e-20
GQ449374.1  Triticum turgidum subsp. durum defensin precursor (PR...  92.0    7e-20
LN809934.1  Zea mays Defensin gene, cultivar MaiSon                   85.5    7e-20
KJ551526.1  Triticum aestivum cultivar Chinese Spring defensin (P...  87.8    8e-20
XM_004953118.3  PREDICTED: Setaria italica defensin Tm-AMP-D1.2-l...  88.6    8e-20
GQ449375.1  Triticum turgidum subsp. durum defensin precursor (PR...  91.7    1e-19
EU958657.1  Zea mays clone 1708375 low-molecular-weight cysteine-...  87.0    1e-19
LN650979.1  Zea mays mRNA for Defensin protein (Defensin gene), c...  84.0    1e-19
BT009167.1  Triticum aestivum clone wl1n.pk0096.c8:fis, full inse...  87.4    2e-19
EU952901.1  Zea mays clone 1336370 low-molecular-weight cysteine-...  86.7    2e-19
EU958628.1  Zea mays clone 1706440 low-molecular-weight cysteine-...  86.3    2e-19
NM_001155758.2  Zea mays uncharacterized LOC100282852 (pco090777)...  87.4    2e-19
EU962530.1  Zea mays clone 243478 low-molecular-weight cysteine-r...  87.0    3e-19
EU958634.1  Zea mays clone 1706684 low-molecular-weight cysteine-...  85.9    3e-19
XM_002452439.1  Sorghum bicolor hypothetical protein, mRNA            85.9    3e-19
AY109044.1  Zea mays PCO090777 mRNA sequence                          87.4    4e-19
BT009185.1  Triticum aestivum clone wl1n.pk0135.h12:fis, full ins...  86.3    5e-19
AK224369.1  Oryza officinalis cDNA, clone: CCP06G10, expressed in...  85.9    5e-19
XM_004976203.2  PREDICTED: Setaria italica defensin Tk-AMP-D1-lik...  85.1    5e-19
AY108568.1  Zea mays PCO111219 mRNA sequence                          86.3    5e-19
GQ449373.1  Triticum turgidum subsp. durum defensin precursor (PR...  89.4    6e-19
EU957417.1  Zea mays clone 1591261 low-molecular-weight cysteine-...  86.3    6e-19
EU961911.1  Zea mays clone 238984 low-molecular-weight cysteine-r...  86.3    7e-19
DQ244829.1  Zea mays clone 11039 mRNA sequence                        86.3    7e-19
CT833840.1  Oryza sativa (indica cultivar-group) cDNA clone:OSIGC...  85.5    7e-19
AK121915.1  Oryza sativa Japonica Group cDNA clone:J033106C08, fu...  85.5    7e-19
NM_001153529.1  Zea mays uncharacterized LOC100280611 (pco111219a...  86.3    8e-19
XM_015768577.1  PREDICTED: Oryza sativa Japonica Group defensin T...  85.5    9e-19
EU944119.1  Zea mays clone 1708720 mRNA sequence                      84.3    1e-18
LN878138.1  Zea mays defensin pseudogene, cultivar LVN99              82.4    1e-18
XM_015836489.1  PREDICTED: Oryza brachyantha defensin Tk-AMP-D1-l...  80.9    3e-18
GQ449378.1  Triticum turgidum subsp. durum defensin precursor (PR...  87.0    4e-18
XM_004976204.1  PREDICTED: Setaria italica defensin Tk-AMP-D2-lik...  82.0    5e-18
EU965804.1  Zea mays clone 289072 hypothetical protein mRNA, comp...  84.3    7e-18
EU969138.1  Zea mays clone 326270 low-molecular-weight cysteine-r...  83.2    9e-18
XM_015780888.1  PREDICTED: Oryza sativa Japonica Group defensin T...  81.3    3e-17
XM_016096860.1  PREDICTED: Arachis duranensis defensin Ec-AMP-D2-...  80.9    3e-17
DQ099064.1  Arachis stenosperma clone AS1RN9A05 microsatellite se...  79.3    8e-17
XM_016329551.1  PREDICTED: Arachis ipaensis defensin Ec-AMP-D2-li...  79.3    1e-16
AP006168.3  Oryza sativa Japonica Group genomic DNA, chromosome 2...  81.6    3e-16
AP014958.1  Oryza sativa Japonica Group DNA, chromosome 2, cultiv...  81.6    3e-16
CP012610.1  Oryza sativa Indica Group cultivar RP Bio-226 chromos...  81.6    3e-16
AK224243.1  Oryza punctata cDNA, clone: BBS18D09, expressed in sh...  77.8    3e-16
AK287660.1  Oryza sativa Japonica Group cDNA, clone: J065112B21, ...  81.3    4e-16
AK241145.1  Oryza sativa Japonica Group cDNA, clone: J065112B21, ...  81.3    4e-16
CR855210.1  Oryza sativa genomic DNA, chromosome 4, BAC clone: OS...  80.5    7e-16
AL662958.3  Oryza sativa genomic DNA, chromosome 4, BAC clone: OS...  80.5    7e-16
CP012612.1  Oryza sativa Indica Group cultivar RP Bio-226 chromos...  80.5    7e-16
AP014960.1  Oryza sativa Japonica Group DNA, chromosome 4, cultiv...  80.5    7e-16
XM_016645980.1  PREDICTED: Nicotiana tabacum defensin-like protei...  75.1    1e-15
FP095070.1  Phyllostachys edulis cDNA clone: bphyst015o17, full i...  77.4    1e-15
EF557459.1  Oryza sativa (indica cultivar-group) clone IR42253_5F...  73.6    2e-15
EF557975.1  Oryza sativa (indica cultivar-group) clone N22B_51FSF...  72.4    3e-15
XM_009770613.1  PREDICTED: Nicotiana sylvestris defensin-like pro...  75.1    4e-15
XM_009601061.1  PREDICTED: Nicotiana tomentosiformis defensin-lik...  73.2    7e-15
XM_003629284.2  Medicago truncatula Defensin MtDef4.5 mRNA            72.8    8e-15
AY498565.1  Capsicum annuum defensin precursor mRNA, complete cds     73.2    9e-15
XM_006359424.1  PREDICTED: Solanum tuberosum defensin-like protei...  72.8    1e-14
XM_016608527.1  PREDICTED: Nicotiana tabacum defensin-like protei...  73.2    1e-14
XM_009804353.1  PREDICTED: Nicotiana sylvestris defensin-like pro...  73.2    1e-14
AY695796.1  Ginkgo biloba defensin precursor, mRNA, complete cds      73.9    1e-14
XM_009616372.1  PREDICTED: Nicotiana tomentosiformis defensin-lik...  74.3    1e-14
DQ244495.1  Zea mays clone 8537 mRNA sequence                         74.3    1e-14
KX688721.1  Nicotiana alata class I defensin mRNA, complete cds       71.2    2e-14
XM_016578132.1  PREDICTED: Nicotiana tabacum defensin-like protei...  72.8    2e-14
XM_016700063.1  PREDICTED: Capsicum annuum defensin Ec-AMP-D1-lik...  74.3    2e-14
EF421192.1  Nelumbo nucifera defensin mRNA, complete cds              73.6    2e-14
XM_009770612.1  PREDICTED: Nicotiana sylvestris defensin-like pro...  73.2    2e-14
XM_010272475.1  PREDICTED: Nelumbo nucifera defensin-like protein...  73.6    2e-14
EF506491.1  Olea europaea putative defensin protein 1 mRNA, parti...  71.6    3e-14
FJ623460.1  Jatropha curcas low-molecular-weight cysteine-rich 69...  70.1    4e-14
XM_004976202.2  PREDICTED: Setaria italica defensin-like protein ...  72.4    6e-14
BT117945.1  Picea glauca clone GQ03918_C16 mRNA sequence              72.0    6e-14
XM_014652387.1  PREDICTED: Vigna radiata var. radiata defensin Ec...  72.0    6e-14
AF442388.1  Capsicum annuum defensin protein precursor, mRNA, com...  72.0    7e-14
JN980401.1  Pinus sylvestris defensin 3 (Def3) mRNA, complete cds     69.7    7e-14
FJ489605.1  Jatropha curcas defensin mRNA, complete cds               68.9    1e-13
GQ449376.1  Triticum turgidum subsp. durum defensin precursor (PR...  73.9    1e-13
EF455616.1  Pinus sylvestris defensin (Def1) mRNA, complete cds       68.9    1e-13
XM_012222860.1  PREDICTED: Jatropha curcas defensin-like protein ...  70.1    2e-13
NM_001310318.1  Solanum lycopersicum defensin-like protein (LOC10...  69.7    2e-13
XM_015226386.1  PREDICTED: Solanum pennellii defensin-like protei...  69.7    2e-13
EF455617.1  Pinus sylvestris defensin (Def2) mRNA, complete cds       68.6    2e-13
JX576265.1  Solanum tuberosum clone St-DNT109 protease inhibitor-...  68.2    2e-13
XM_007156329.1  Phaseolus vulgaris hypothetical protein (PHAVU_00...  70.5    2e-13
XM_009594998.1  PREDICTED: Nicotiana tomentosiformis defensin-lik...  70.5    2e-13
KJ788079.1  Solanum tuberosum clone PI4341 defensin-like protein ...  68.6    2e-13
XM_016594790.1  PREDICTED: Nicotiana tabacum defensin-like protei...  70.9    2e-13
KJ601732.1  Pinus sylvestris defensin 4 mRNA, complete cds            68.2    2e-13
XM_009771541.1  PREDICTED: Nicotiana sylvestris defensin-like pro...  70.5    2e-13
KJ788076.1  Solanum tuberosum clone PI1733 defensin-like protein ...  68.2    3e-13
AY494051.1  Picea glauca defensin mRNA, complete cds                  69.7    3e-13
JQ654634.1  Nicotiana tabacum defensin (DEF1) mRNA, complete cds      70.5    3e-13
XM_016595723.1  PREDICTED: Nicotiana tabacum defensin-like protei...  70.5    4e-13
XM_004954757.2  PREDICTED: Setaria italica defensin Tm-AMP-D1.2-l...  70.9    4e-13
EF678104.1  Picea sitchensis clone WS02822_J18 unknown mRNA           70.1    4e-13
EF084177.1  Picea sitchensis clone WS0291_B05 unknown mRNA            70.1    4e-13
AF322914.1  Elaeis guineensis defensin EGAD1 mRNA, complete cds       70.1    4e-13
AB034956.1  Nicotiana tabacum mRNA for thionin like protein, comp...  70.5    4e-13
U72942.2  Oryza sativa proteinase inhibitor (RPI) mRNA, complete cds  68.9    5e-13
BT070283.1  Picea sitchensis clone WS02717_A13 unknown mRNA           69.7    5e-13
EF083702.1  Picea sitchensis clone WS0295_K17 unknown mRNA            69.7    5e-13
XM_002468536.1  Sorghum bicolor hypothetical protein, mRNA            70.5    5e-13
BT104530.1  Picea glauca clone GQ02811_I12 mRNA sequence              69.7    5e-13
FQ387342.1  Vitis vinifera clone SS0AEB26YN04                         69.7    5e-13
EF084074.1  Picea sitchensis clone WS0272_A04 unknown mRNA            70.1    5e-13
BT070598.1  Picea sitchensis clone WS02738_P08 unknown mRNA           69.7    5e-13
FQ384899.1  Vitis vinifera clone SS0AEB4YB02                          69.3    5e-13
XM_017573059.1  PREDICTED: Vigna angularis defensin Ec-AMP-D2-lik...  69.7    5e-13
XM_006359423.1  PREDICTED: Solanum tuberosum defensin-like protei...  68.2    5e-13
FQ392292.1  Vitis vinifera clone SS0AFA6YG07                          69.3    6e-13
BT070807.1  Picea sitchensis clone WS02750_O01 unknown mRNA           70.1    6e-13
FQ388050.1  Vitis vinifera clone SS0AEB24YG21                         69.7    6e-13
FQ386514.1  Vitis vinifera clone SS0AEB29YK11                         69.3    6e-13
FQ385666.1  Vitis vinifera clone SS0AEB31YI09                         69.3    6e-13
HM240259.1  Phaseolus vulgaris cultivar BAT93 defensin D2 mRNA, c...  70.1    6e-13
XM_016640369.1  PREDICTED: Nicotiana tabacum defensin J1-2-like (...  69.3    6e-13
FQ393327.1  Vitis vinifera clone SS0AFA26YJ07                         69.3    6e-13
FQ385920.1  Vitis vinifera clone SS0AEB30YK02                         69.3    6e-13
FQ389825.1  Vitis vinifera clone SS0AEB19YJ01                         69.3    6e-13
FQ386860.1  Vitis vinifera clone SS0AEB28YI04                         69.3    6e-13
FQ378957.1  Vitis vinifera clone SS0AEB11YO08                         69.3    6e-13
FQ388235.1  Vitis vinifera clone SS0AEB23YM16                         69.3    6e-13
FQ389552.1  Vitis vinifera clone SS0AEB1YH03                          69.3    6e-13
XM_009606271.1  PREDICTED: Nicotiana tomentosiformis defensin J1-...  68.9    6e-13
FQ389592.1  Vitis vinifera clone SS0AEB1YE24                          69.3    6e-13
XM_009611916.1  PREDICTED: Nicotiana tomentosiformis defensin J1-...  69.3    6e-13
FQ390520.1  Vitis vinifera clone SS0AEB17YH17                         69.3    7e-13
FQ391273.1  Vitis vinifera clone SS0AEB15YD04                         69.3    7e-13
FQ390795.1  Vitis vinifera clone SS0AEB16YK10                         69.3    7e-13
FQ385139.1  Vitis vinifera clone SS0AEB3YE02                          69.3    7e-13
JQ654635.1  Nicotiana tabacum defensin (DEF2) mRNA, complete cds      68.9    7e-13
FQ387008.1  Vitis vinifera clone SS0AEB28YA08                         69.3    7e-13
EF677104.1  Picea sitchensis clone WS02761_N13 unknown mRNA           69.7    7e-13
XM_004985795.1  PREDICTED: Setaria italica defensin SD2-like (LOC...  70.5    7e-13
XM_003628931.1  Medicago truncatula Defensin MtDef4.4 partial mRNA    67.0    7e-13
AY108837.1  Zea mays PCO070355 mRNA sequence                          69.7    7e-13
XM_016638641.1  PREDICTED: Nicotiana tabacum defensin J1-2 (LOC10...  69.3    7e-13
X91487.1  P.abies mRNA for gamma-thionin protein (putative)           68.9    8e-13
XM_016659151.1  PREDICTED: Nicotiana tabacum defensin J1-2-like (...  68.9    8e-13
XM_016659150.1  PREDICTED: Nicotiana tabacum defensin J1-2-like (...  68.9    8e-13
FQ386967.1  Vitis vinifera clone SS0AEB28YC19                         69.3    8e-13
FQ395665.1  Vitis vinifera clone SS0AFA14YL10                         69.3    8e-13
FJ132500.1  Pinus taeda isolate 6798 anonymous locus CL2287Contig...  66.6    8e-13
FJ132488.1  Pinus taeda isolate 6802 anonymous locus CL2287Contig...  66.6    8e-13
DQ224256.1  Aquilegia formosa putative defensin (DEF1) mRNA, part...  67.8    8e-13
XM_010910678.1  PREDICTED: Elaeis guineensis defensin Ec-AMP-D1-l...  70.1    8e-13
FQ388011.1  Vitis vinifera clone SS0AEB24YI18                         69.3    8e-13
EF083778.1  Picea sitchensis clone WS02722_N20 unknown mRNA           69.7    8e-13
FQ386663.1  Vitis vinifera clone SS0AEB29YC19                         69.3    9e-13
EF081628.1  Picea sitchensis clone WS02814_K22 unknown mRNA           69.7    9e-13
BT115656.1  Picea glauca clone GQ03703_N18 mRNA sequence              69.7    1e-12
XM_009616193.1  PREDICTED: Nicotiana tomentosiformis defensin J1-...  68.9    1e-12
XM_002274317.2  PREDICTED: Vitis vinifera defensin Ec-AMP-D2 (LOC...  69.3    1e-12
NM_001156902.1  Zea mays low-molecular-weight cysteine-rich prote...  69.7    1e-12
BT115846.1  Picea glauca clone GQ03707_G02 mRNA sequence              69.3    1e-12
XM_015773314.1  PREDICTED: Oryza sativa Japonica Group defensin-l...  68.2    1e-12
XM_009793922.1  PREDICTED: Nicotiana sylvestris defensin-like pro...  67.8    1e-12
BT131396.1  Oryza sativa clone RRlibD00348 mRNA sequence              68.2    2e-12
XM_016620513.1  PREDICTED: Nicotiana tabacum defensin J1-2-like (...  68.2    2e-12
KX139061.1  Nicotiana benthamiana defensin-like protein 2 mRNA, c...  65.9    2e-12
XM_009801834.1  PREDICTED: Nicotiana sylvestris defensin J1-2-lik...  68.2    2e-12
NM_001159479.1  Zea mays uncharacterized LOC100285747 (pco070355)...  68.9    2e-12
AY307056.1  Hyacinthus orientalis cultivar Delft Blue proteinase ...  67.4    2e-12
EF145840.1  Populus trichocarpa clone WS0113_L16 unknown mRNA         67.8    2e-12
EF144814.1  Populus trichocarpa clone WS01118_J09 unknown mRNA        67.8    2e-12
EF145374.1  Populus trichocarpa clone WS01123_N11 unknown mRNA        67.8    2e-12
EF144827.1  Populus trichocarpa clone WS01118_L07 unknown mRNA        67.8    2e-12
AK120826.1  Oryza sativa Japonica Group cDNA clone:J023019E10, fu...  68.2    2e-12
EF081568.1  Picea sitchensis clone WS0285_L10 unknown mRNA            68.2    2e-12
FQ390153.1  Vitis vinifera clone SS0AEB18YJ05                         68.2    2e-12
FQ386817.1  Vitis vinifera clone SS0AEB28YK09                         68.2    2e-12
FQ379531.1  Vitis vinifera clone SS0AEB10YC18                         68.2    2e-12
FQ389253.1  Vitis vinifera clone SS0AEB20YG12                         68.2    2e-12
FQ390247.1  Vitis vinifera clone SS0AEB18YE19                         68.2    2e-12
KP017278.1  Nicotiana benthamiana defensin-like protein 1.2 (PDF1...  65.9    2e-12
FQ397945.1  Vitis vinifera clone SS0AEB5YD07                          68.2    2e-12
FQ379599.1  Vitis vinifera clone SS0AEA1YP12                          68.2    2e-12
FQ378998.1  Vitis vinifera clone SS0AEB11YM09                         68.2    2e-12
FQ390306.1  Vitis vinifera clone SS0AEB18YC03                         68.2    2e-12
EU849681.1  Solanum tuberosum protease inhibitor-related protein ...  67.8    2e-12
FQ385637.1  Vitis vinifera clone SS0AEB31YJ18                         67.8    2e-12
FQ387078.1  Vitis vinifera clone SS0AEB27YM06                         67.8    2e-12
EF085766.1  Picea sitchensis clone WS02752_G19 unknown mRNA           68.6    2e-12
EF086006.1  Picea sitchensis clone WS02922_O20 unknown mRNA           68.6    3e-12
FQ389397.1  Vitis vinifera clone SS0AEB1YP12                          67.8    3e-12
FQ391109.1  Vitis vinifera clone SS0AEB15YK13                         67.8    3e-12
FQ378674.1  Vitis vinifera clone SS0AEB12YN15                         67.8    3e-12
XM_006585813.2  PREDICTED: Glycine max defensin-like protein (LOC...  68.6    3e-12
X99403.1  N.tabacum mRNA for defensin                                 67.4    3e-12


>KF410865.1 Triticum aestivum cultivar MB105 defensin gene, complete cds
Length=249

 Score = 132 bits (331),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MASTRRMAAAPAVLLLLLLLVATEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE
Sbjct  1    MASTRRMAAAPAVLLLLLLLVATEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  180

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFPDGECNTHLVERKCYCKRTC*
Sbjct  181  NFPDGECNTHLVERKCYCKRTC*  249


>KJ551528.1 Triticum aestivum cultivar Chinese Spring defensin (PDF13) mRNA, 
complete cds
Length=655

 Score = 132 bits (331),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MASTRRMAAAPAVLLLLLLLVATEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE
Sbjct  73   MASTRRMAAAPAVLLLLLLLVATEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  252

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFPDGECNTHLVERKCYCKRTC*
Sbjct  253  NFPDGECNTHLVERKCYCKRTC*  321


>AB089942.1 Triticum aestivum Tad1 mRNA for defensin, complete cds
Length=682

 Score = 132 bits (331),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MASTRRMAAAPAVLLLLLLLVATEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE
Sbjct  100  MASTRRMAAAPAVLLLLLLLVATEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  279

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFPDGECNTHLVERKCYCKRTC*
Sbjct  280  NFPDGECNTHLVERKCYCKRTC*  348


>AK358090.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete 
cds, clone: NIASHv1068I05
Length=571

 Score = 121 bits (304),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllv-aTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRT  59
            MAS RRM+AAPA+LLLLLL++ ATEMGTMK AEARTCLSQSHKFKGTCLSNSNCA VCRT
Sbjct  61   MASPRRMSAAPALLLLLLLVLVATEMGTMKAAEARTCLSQSHKFKGTCLSNSNCAGVCRT  240

Query  60   ENFPDGECNTHLVERKCYCKRTC*  83
            ENFPDGECN+H +ERKCYCKRTC*
Sbjct  241  ENFPDGECNSHRLERKCYCKRTC*  312


>BT009107.1 Triticum aestivum clone wkm2n.pk009.f17:fis, full insert mRNA 
sequence
Length=629

 Score = 119 bits (297),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +3

Query  1    MASTRRMaaapavlllllllva-TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRT  59
            MAS RRMAAAPAVLLL+LLL+  TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCA VCRT
Sbjct  108  MASPRRMAAAPAVLLLVLLLLVATEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAGVCRT  287

Query  60   ENFPDGECNTHLVERKCYCKRTC*  83
            ENFPDGECN+H +ERKC+CKRTC*
Sbjct  288  ENFPDGECNSHRLERKCFCKRTC*  359


>KJ551523.1 Triticum aestivum cultivar Chinese Spring defensin (PDF8) mRNA, 
complete cds
Length=646

 Score = 119 bits (297),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllva-TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRT  59
            MAS RRMAAAPAVLLL+LLL+  TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCA VCRT
Sbjct  101  MASPRRMAAAPAVLLLVLLLLVATEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAGVCRT  280

Query  60   ENFPDGECNTHLVERKCYCKRTC*  83
            ENFPDGECN+H +ERKC+CKRTC*
Sbjct  281  ENFPDGECNSHRLERKCFCKRTC*  352


>KJ551517.1 Triticum aestivum cultivar Chinese Spring defensin (PDF2) mRNA, 
complete cds
Length=502

 Score = 116 bits (290),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MAS R MAAAPAVLLLLLLLVATEMGT K AEARTCLSQSHKFKGTCLS+SNCA VCRTE
Sbjct  44   MASRRPMAAAPAVLLLLLLLVATEMGTTKVAEARTCLSQSHKFKGTCLSDSNCAGVCRTE  223

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFPDGECN+H +ERKC+CKRTC*
Sbjct  224  NFPDGECNSHRLERKCFCKRTC*  292


>BT009554.1 Triticum aestivum clone wre1.pk0001.d8:fis, full insert mRNA 
sequence
Length=631

 Score = 115 bits (289),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MAS  R AA PAVLLLLLLLVATEMGT K  EARTCLSQSHKFKGTCLS+SNCA VCRTE
Sbjct  57   MASPSRTAATPAVLLLLLLLVATEMGTTKVVEARTCLSQSHKFKGTCLSDSNCAGVCRTE  236

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFPDGECN+H +ERKC+CKRTC*
Sbjct  237  NFPDGECNSHRLERKCFCKRTC*  305


>JQ435849.1 Triticum aestivum cultivar Falat defensin precursor, mRNA, partial 
cds
Length=245

 Score = 111 bits (278),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            EMGT+KTAEARTCLSQSHKFKGTC+S+SNCA VCRTENFPDGECN+H +ERKC+CKRTC
Sbjct  69   EMGTLKTAEARTCLSQSHKFKGTCISDSNCAGVCRTENFPDGECNSHRLERKCHCKRTC  245


>KJ551525.1 Triticum aestivum cultivar Chinese Spring defensin (PDF10) mRNA, 
complete cds
Length=643

 Score = 115 bits (288),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MAS  R AA PAVLLLLLLLVATEMGT K  EARTCLSQSHKFKGTCLS+SNCA VCRTE
Sbjct  50   MASPSRTAATPAVLLLLLLLVATEMGTTKVVEARTCLSQSHKFKGTCLSDSNCAGVCRTE  229

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFPDGECN+H +ERKC+CKRTC*
Sbjct  230  NFPDGECNSHRLERKCFCKRTC*  298


>BT009066.1 Triticum aestivum clone wem1c.pk001.k1:fis, full insert mRNA 
sequence
 KJ551530.1 Triticum aestivum cultivar Chinese Spring defensin (PDF15) mRNA, 
complete cds
Length=635

 Score = 106 bits (264),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 73/85 (86%), Gaps = 2/85 (2%)
 Frame = +2

Query  1    MASTRRM--aaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCR  58
            MAS RRM  AA PAVLL+LLLLVATEMGT KTAEARTC SQSHKFKG C S+SNCA VCR
Sbjct  149  MASPRRMGMAAVPAVLLILLLLVATEMGTTKTAEARTCESQSHKFKGPCFSDSNCATVCR  328

Query  59   TENFPDGECNTHLVERKCYCKRTC*  83
            TENFP G+CNTH VERKCYC+R C*
Sbjct  329  TENFPRGQCNTHHVERKCYCERDC*  403


>KJ551529.1 Triticum aestivum cultivar Chinese Spring defensin (PDF14) mRNA, 
complete cds
Length=482

 Score = 101 bits (252),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MAS RRMA APAVLL+LLLLVATEMGT+K AEARTC SQSH FKG C S++NCA+VC TE
Sbjct  88   MASPRRMATAPAVLLVLLLLVATEMGTVKVAEARTCESQSHNFKGACFSDTNCASVCHTE  267

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP G+C+ H VERKCYC+R C*
Sbjct  268  NFPRGQCHQHHVERKCYCERDC*  336


>KJ551524.1 Triticum aestivum cultivar Chinese Spring defensin (PDF9) mRNA, 
complete cds
Length=617

 Score = 102 bits (253),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 69/85 (81%), Gaps = 4/85 (5%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTM--KTAEARTCLSQSHKFKGTCLSNSNCAAVCR  58
            MA TRRMAA+  +LLLLL+   TEMGT   KTAEAR CLSQSHKFKG CLS+SNCA VCR
Sbjct  88   MALTRRMAASALLLLLLLVA--TEMGTTRTKTAEARDCLSQSHKFKGACLSSSNCAGVCR  261

Query  59   TENFPDGECNTHLVERKCYCKRTC*  83
            TENFPDGEC+TH   RKC+CKR C*
Sbjct  262  TENFPDGECHTHNFARKCFCKRAC*  336


>BT009231.1 Triticum aestivum clone wle1n.pk0096.f4:fis, full insert mRNA 
sequence
Length=637

 Score = 101 bits (252),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 69/85 (81%), Gaps = 4/85 (5%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTM--KTAEARTCLSQSHKFKGTCLSNSNCAAVCR  58
            MA TRRMAA+  +LLLLL+   TEMGT   KTAEAR CLSQSHKFKG CLS+SNCA VCR
Sbjct  88   MALTRRMAASALLLLLLLVA--TEMGTTRTKTAEARDCLSQSHKFKGACLSSSNCAGVCR  261

Query  59   TENFPDGECNTHLVERKCYCKRTC*  83
            TENFPDGEC+TH   RKC+CKR C*
Sbjct  262  TENFPDGECHTHNFARKCFCKRAC*  336


>BT008925.1 Triticum aestivum clone waw1c.pk005.e22:fis, full insert mRNA 
sequence
Length=662

 Score = 101 bits (252),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 2/63 (3%)
 Frame = +1

Query  23   TEMG--TMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMG  T+K AEAR CLSQSHKFKG CLS+SNCAAVCRTENFPDGEC+TH   RKC+CKR
Sbjct  154  TEMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKR  333

Query  81   TC*  83
             C*
Sbjct  334  AC*  342


>KJ551519.1 Triticum aestivum cultivar Chinese Spring defensin (PDF4) mRNA, 
complete cds
Length=669

 Score = 101 bits (252),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 2/63 (3%)
 Frame = +1

Query  23   TEMG--TMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMG  T+K AEAR CLSQSHKFKG CLS+SNCAAVCRTENFPDGEC+TH   RKC+CKR
Sbjct  142  TEMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKR  321

Query  81   TC*  83
             C*
Sbjct  322  AC*  330


>FP098065.1 Phyllostachys edulis cDNA clone: bphyst012p01, full insert sequence
Length=510

 Score = 98.6 bits (244),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MGT K  EAR CLSQSHKFKG C+SN+NCA VCRTENFP GEC +H +ERKC+CK+ C
Sbjct  151  TDMGTTKVGEARHCLSQSHKFKGMCMSNNNCANVCRTENFPGGECKSHGIERKCFCKKVC  330

Query  83   *  83
            *
Sbjct  331  *  333


>XM_006647489.2 PREDICTED: Oryza brachyantha defensin Tm-AMP-D1.2-like (LOC102720400), 
mRNA
Length=731

 Score = 100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 67/83 (81%), Gaps = 2/83 (2%)
 Frame = +3

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRM A+  +LL +L+   TEMGT + AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  135  MAPSRRMVASVFLLLAILVA--TEMGTTQVAEARHCLSQSHRFKGMCVSSNNCANVCKTE  308

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFPDGEC +H +ERKC+CK+ C*
Sbjct  309  NFPDGECKSHGLERKCFCKKLC*  377


>GQ449372.1 Triticum aestivum defensin precursor (PRPI) mRNA, complete cds
Length=677

 Score = 99.0 bits (245),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 5/85 (6%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGT--MKTAEARTCLSQSHKFKGTCLSNSNCAAVCR  58
            MA +RRM A+  +L LL+    TEMGT  +K AEAR CLSQSH FKG CLS+SNCAAVCR
Sbjct  109  MALSRRMTASALLLFLLVA---TEMGTTTVKVAEARNCLSQSHNFKGACLSSSNCAAVCR  279

Query  59   TENFPDGECNTHLVERKCYCKRTC*  83
            TENFPDGEC+    ERKC+CKR C*
Sbjct  280  TENFPDGECHAPHYERKCFCKRPC*  354


>AK436613.1 Brachypodium distachyon mRNA, clone: PL016C01-A-080_J14
Length=524

 Score = 97.4 bits (241),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +ERKC+CKR C
Sbjct  69   TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  248

Query  83   *  83
            *
Sbjct  249  *  251


>KJ551516.1 Triticum aestivum cultivar Chinese Spring defensin (PDF1) mRNA, 
complete cds
Length=693

 Score = 99.0 bits (245),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 5/85 (6%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGT--MKTAEARTCLSQSHKFKGTCLSNSNCAAVCR  58
            MA +RRM A+  +L LL+    TEMGT  +K AEAR CLSQSH FKG CLS+SNCAAVCR
Sbjct  107  MALSRRMTASALLLFLLVA---TEMGTTTVKVAEARNCLSQSHNFKGACLSSSNCAAVCR  277

Query  59   TENFPDGECNTHLVERKCYCKRTC*  83
            TENFPDGEC+    ERKC+CKR C*
Sbjct  278  TENFPDGECHAPHYERKCFCKRPC*  352


>FP101274.1 Phyllostachys edulis cDNA clone: bphylf002b05, full insert sequence
Length=641

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MGT K  EAR CLSQSHKFKG C+SN+NCA VCRTENFP GEC +H +ERKC+CK+ C
Sbjct  152  TDMGTTKVGEARHCLSQSHKFKGMCMSNNNCANVCRTENFPGGECKSHGIERKCFCKKVC  331

Query  83   *  83
            *
Sbjct  332  *  334


>AK434755.1 Brachypodium distachyon mRNA, clone: PL016C01-A-068_A05
Length=524

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +ERKC+CKR C
Sbjct  137  TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  316

Query  83   *  83
            *
Sbjct  317  *  319


>AK430986.1 Brachypodium distachyon mRNA, clone: PL016C01-A-043_N19
Length=524

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +ERKC+CKR C
Sbjct  169  TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  348

Query  83   *  83
            *
Sbjct  349  *  351


>FP093864.1 Phyllostachys edulis cDNA clone: bphyst002e09, full insert sequence
Length=645

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MGT K  EAR CLSQSHKFKG C+SN+NCA VCRTENFP GEC +H +ERKC+CK+ C
Sbjct  151  TDMGTTKVGEARHCLSQSHKFKGMCMSNNNCANVCRTENFPGGECKSHGIERKCFCKKVC  330

Query  83   *  83
            *
Sbjct  331  *  333


>FP099650.1 Phyllostachys edulis cDNA clone: bbasst002l03, full insert sequence
Length=660

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MGT K AEAR CLSQSHKFKGTCLS++NCA VC TENFP GEC +H VERKC+CK+ C
Sbjct  158  TDMGTTKVAEARHCLSQSHKFKGTCLSSNNCANVCSTENFPGGECKSHGVERKCFCKKVC  337

Query  83   *  83
            *
Sbjct  338  *  340


>BT009100.1 Triticum aestivum clone wkm2n.pk003.d23:fis, full insert mRNA 
sequence
Length=635

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +3

Query  23   TEMG--TMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMG  T KTAEAR CLSQSHKF G CLS+SNCA VCRTENFPDGEC+T   ERKC+CKR
Sbjct  162  TEMGATTTKTAEARDCLSQSHKFNGACLSSSNCAGVCRTENFPDGECHTQHFERKCFCKR  341


>AK426421.1 Brachypodium distachyon mRNA, clone: PL016C01-A-014_E18
Length=573

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +ERKC+CKR C
Sbjct  135  TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  314

Query  83   *  83
            *
Sbjct  315  *  317


>AK434997.1 Brachypodium distachyon mRNA, clone: PL016C01-A-069_J11
Length=592

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +ERKC+CKR C
Sbjct  137  TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  316

Query  83   *  83
            *
Sbjct  317  *  319


>AK432974.1 Brachypodium distachyon mRNA, clone: PL016C01-A-056_M09
Length=591

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +ERKC+CKR C
Sbjct  135  TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  314

Query  83   *  83
            *
Sbjct  315  *  317


>AK428189.1 Brachypodium distachyon mRNA, clone: PL016C01-A-025_L03
Length=595

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +ERKC+CKR C
Sbjct  135  TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  314

Query  83   *  83
            *
Sbjct  315  *  317


>AK436080.1 Brachypodium distachyon mRNA, clone: PL016C01-A-077_C12
Length=604

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +ERKC+CKR C
Sbjct  135  TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  314

Query  83   *  83
            *
Sbjct  315  *  317


>AK431842.1 Brachypodium distachyon mRNA, clone: PL016C01-A-049_G10
Length=606

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +ERKC+CKR C
Sbjct  135  TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  314

Query  83   *  83
            *
Sbjct  315  *  317


>XM_003575364.3 PREDICTED: Brachypodium distachyon defensin Tm-AMP-D1.2-like 
(LOC100844099), mRNA
Length=634

 Score = 97.1 bits (240),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +ERKC+CKR C
Sbjct  158  TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  337

Query  83   *  83
            *
Sbjct  338  *  340


>AK250623.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf87f13, mRNA sequence
Length=766

 Score = 97.4 bits (241),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 2/62 (3%)
 Frame = +3

Query  24   EMG--TMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRT  81
            EMG  T+K AEAR CLSQSHKFKGTCLS+SNCAAVCRTENFPDG+C+T  + RKC+CKR 
Sbjct  273  EMGATTVKVAEARDCLSQSHKFKGTCLSSSNCAAVCRTENFPDGQCHTQNLARKCFCKRV  452

Query  82   C*  83
            C*
Sbjct  453  C*  458


>BT008931.1 Triticum aestivum clone wde2f.pk001.g2:fis, full insert mRNA 
sequence
Length=557

 Score = 95.5 bits (236),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEARTC SQSH FKG C S++NCA+VCRTENFP G+C+ H +ERKCYC+R C
Sbjct  114  TEMGTTKVAEARTCESQSHNFKGACFSDTNCASVCRTENFPRGQCHQHHLERKCYCERDC  293

Query  83   *  83
            *
Sbjct  294  *  296


>KJ551522.1 Triticum aestivum cultivar Chinese Spring defensin (PDF7) mRNA, 
complete cds
Length=723

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 4/85 (5%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKT--AEARTCLSQSHKFKGTCLSNSNCAAVCR  58
            MA +RRMAA+  +LL+LL+   TE+G  +T  AEAR CLSQSHKFKG CLS+SNCA VCR
Sbjct  100  MAPSRRMAASALLLLVLLVA--TEIGATRTKVAEARDCLSQSHKFKGACLSSSNCAGVCR  273

Query  59   TENFPDGECNTHLVERKCYCKRTC*  83
            TENFPDGEC+TH   RKC+CKR C*
Sbjct  274  TENFPDGECHTHNFARKCFCKRAC*  348


>GQ449377.1 Triticum turgidum subsp. durum defensin precursor (PRPI-7) gene, 
complete cds
Length=3491

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 53/63 (84%), Gaps = 2/63 (3%)
 Frame = +3

Query  23    TEMG--TMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
              EMG  T+K AEAR CLSQSHKFKG CLS+SNCAAVCRTENFPDGEC+TH   RKC+CKR
Sbjct  2928  AEMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKR  3107

Query  81    TC*  83
              C*
Sbjct  3108  PC*  3116


>FP093414.1 Phyllostachys edulis cDNA clone: bphyst019l07, full insert sequence
Length=874

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            +MGT K  EAR CLSQSHKFKG C+SN+NCA VCRTENFP GEC +H +ERKC+CK+ C*
Sbjct  287  DMGTTKVGEARHCLSQSHKFKGMCMSNNNCANVCRTENFPGGECKSHGIERKCFCKKVC*  466


>AK424742.1 Brachypodium distachyon mRNA, clone: PL016C01-A-004_A17
Length=658

 Score = 94.7 bits (234),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGT K AEAR CLSQSHKFKGTC+ + NCA VC+TENFPDGEC T  +E KC+CKR C
Sbjct  169  TEMGTTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLEHKCFCKRVC  348

Query  83   *  83
            *
Sbjct  349  *  351


>EF558101.1 Oryza sativa (indica cultivar-group) clone N22B_5F.z1 genomic 
sequence
Length=228

 Score = 89.4 bits (220),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRT  81
             EMGT K A+A+ CLSQSH+FKG C+S++NCA VCRTE+FPDGEC +H +ERKC+CK+ 
Sbjct  52   AEMGTTKVADAKHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKV  228


>FP094058.1 Phyllostachys edulis cDNA clone: bphylf039j16, full insert sequence
Length=1316

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            +MGT K  EAR CLSQSHKFKG C+SN+NCA VCRTENFP GEC +H +ERKC+CK+ C*
Sbjct  703  DMGTTKVGEARHCLSQSHKFKGMCMSNNNCANVCRTENFPGGECKSHGIERKCFCKKVC*  882


>XM_002446756.1 Sorghum bicolor hypothetical protein, mRNA
Length=249

 Score = 89.0 bits (219),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MAST R   A +VL+ LLLL A+EMGT + AEAR CLSQSHKF G CLS  NCA VCRTE
Sbjct  1    MASTSRRMVASSVLVFLLLLAASEMGTTRVAEARHCLSQSHKFVGACLSKRNCANVCRTE  180

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
             FP GEC  H +E KC+CKR C*
Sbjct  181  GFPWGECRWHGIESKCHCKRIC*  249


>BT009073.1 Triticum aestivum clone wip1c.pk002.f10:fis, full insert mRNA 
sequence
Length=632

 Score = 92.4 bits (228),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = +2

Query  23   TEMGTM--KTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMGT   K AEAR CLSQS KFKG CLS+SNCAAVCRTE FPDGEC+   +ERKC+CKR
Sbjct  194  TEMGTTTTKVAEARDCLSQSFKFKGACLSSSNCAAVCRTEKFPDGECHRQHLERKCFCKR  373

Query  81   TC*  83
             C*
Sbjct  374  PC*  382


>LN650981.1 Zea mays mRNA for Defensin protein (Defensin gene), cultivar 
Luthan
Length=243

 Score = 89.0 bits (219),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LL +   TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  1    MAPSRRMAAPVLVLMLLPVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  174

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  175  NFPGGECKAEGATRKCFCKKIC*  243


>AK250501.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf83i03, mRNA sequence
Length=665

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = +3

Query  23   TEMGT--MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMG   +K A AR C+SQSH FKG CLS+SNCAAVCRTENFP GEC+T  VERKC+CKR
Sbjct  126  TEMGATRVKMAGARDCVSQSHNFKGACLSSSNCAAVCRTENFPGGECHTPHVERKCFCKR  305

Query  81   TC*  83
             C*
Sbjct  306  PC*  314


>KJ551521.1 Triticum aestivum cultivar Chinese Spring defensin (PDF6) mRNA, 
complete cds
Length=645

 Score = 92.4 bits (228),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = +3

Query  23   TEMGTM--KTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMGT   K AEAR CLSQS KFKG CLS+SNCAAVCRTE FPDGEC+   +ERKC+CKR
Sbjct  186  TEMGTTTTKVAEARDCLSQSFKFKGACLSSSNCAAVCRTEKFPDGECHRQHLERKCFCKR  365

Query  81   TC*  83
             C*
Sbjct  366  PC*  374


>AK354890.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete 
cds, clone: NIASHv1012P07
Length=478

 Score = 89.7 bits (221),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 2/61 (3%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG  KTAEARTC SQSHKFKG C S++NCA+VCRTE+FP G C+TH   RKCYC+R C
Sbjct  195  TEMG--KTAEARTCESQSHKFKGACFSDTNCASVCRTEDFPRGHCSTHYAARKCYCERDC  368

Query  83   *  83
            *
Sbjct  369  *  371


>HG792392.1 Zea mays subsp. mays mRNA for defensin (def1 gene), cultivar 
SonLa
 KF761299.1 Zea mays cultivar SonLa defensin 1 (DEF1) mRNA, complete cds
 LN650983.1 Zea mays mRNA for Defensin protein (Defensin gene), cultivar 
Simacai
Length=243

 Score = 87.0 bits (214),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LLL+   TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  1    MAPSRRMAAPVLVLMLLLVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  174

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  175  NFPGGECKAEGATRKCFCKKIC*  243


>EF200066.1 Setaria italica defensin mRNA, complete cds
 JF797205.1 Zea mays subsp. mays cultivar NongDa108 defensin (DEF1) mRNA, 
complete cds
Length=245

 Score = 87.0 bits (214),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LLL+   TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  2    MAPSRRMAAPVLVLMLLLVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  175

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  176  NFPGGECKAEGATRKCFCKKIC*  244


>EU293126.1 Triticum aestivum isolate AI-1 amylase inhibitor-like protein 
mRNA, complete cds
Length=515

 Score = 89.7 bits (221),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  23   TEMGTM--KTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMGT   K AEAR CLS+SHKFKG CLS+SNCA++CRTENFP GEC      RKC+CKR
Sbjct  80   TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  259

Query  81   TC*  83
             C*
Sbjct  260  VC*  268


>KJ551527.1 Triticum aestivum cultivar Chinese Spring defensin (PDF12) mRNA, 
complete cds
Length=567

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  23   TEMGTM--KTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMGT   K AEAR CLS+SHKFKG CLS+SNCA++CRTENFP GEC      RKC+CKR
Sbjct  110  TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  289

Query  81   TC*  83
             C*
Sbjct  290  VC*  298


>EU531731.1 Saccharum officinarum defensin precursor (PDEF) mRNA, complete 
cds
Length=243

 Score = 85.9 bits (211),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TE+GT   AEAR CLSQSH+FKG C+S+SNCA VC+TENFP GEC      RKC+CK+ C
Sbjct  61   TELGTTTVAEARYCLSQSHRFKGLCMSSSNCANVCQTENFPGGECKADGATRKCFCKKIC  240

Query  83   *  83
            *
Sbjct  241  *  243


>KJ551520.1 Triticum aestivum cultivar Chinese Spring defensin (PDF5) mRNA, 
complete cds
Length=666

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  23   TEMGTM--KTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMGT   K AEAR CLSQSH FKG CLS+SNCA VC TE+FP GEC+T   ERKC+CKR
Sbjct  136  TEMGTTTTKLAEARDCLSQSHNFKGACLSSSNCAGVCHTESFPGGECHTQHFERKCFCKR  315

Query  81   TC*  83
             C*
Sbjct  316  VC*  324


>KU575117.1 Saccharum hybrid cultivar CoC 671 defensin 1 (Def1) mRNA, partial 
cds
Length=213

 Score = 85.5 bits (210),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TE+GT   AEAR CLSQSH+FKG C+S+SNCA VC+TENFP GEC      RKC+CK+ C
Sbjct  31   TELGTTTVAEARYCLSQSHRFKGLCMSSSNCANVCQTENFPGGECKADGATRKCFCKKIC  210

Query  83   *  83
            *
Sbjct  211  *  213


>BT009007.1 Triticum aestivum clone wdk2c.pk019.h18:fis, full insert mRNA 
sequence
Length=681

 Score = 89.7 bits (221),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  23   TEMGTM--KTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMGT   K AEAR CLSQSH FKG CLS+SNCA VC TE+FP GEC+T   ERKC+CKR
Sbjct  143  TEMGTTTTKLAEARDCLSQSHNFKGACLSSSNCAGVCHTESFPGGECHTQHFERKCFCKR  322

Query  81   TC*  83
             C*
Sbjct  323  VC*  331


>AK332803.1 Triticum aestivum cDNA, clone: SET1_O13, cultivar: Chinese Spring
Length=620

 Score = 89.4 bits (220),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  23   TEMGTM--KTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMGT   K AEAR CLS+SHKFKG CLS+SNCA++CRTENFP GEC      RKC+CKR
Sbjct  146  TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  325

Query  81   TC*  83
             C*
Sbjct  326  VC*  334


>EU293127.1 Triticum aestivum isolate AI-2 amylase inhibitor-like protein 
mRNA, complete cds
Length=533

 Score = 88.6 bits (218),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +1

Query  23   TEMGT--MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMGT   K AEAR CLS+SHKFKG CLS+SNCA++CRTENFP GEC      RKC+CKR
Sbjct  76   TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  255

Query  81   TC  82
             C
Sbjct  256  VC  261


>LN878139.1 Zea mays defensin gene for mRNA_DEF, cultivar LVN99
Length=243

 Score = 85.9 bits (211),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LL +   TE+GT K AEAR  LSQSH+FKG C+S++NCA VC+TE
Sbjct  1    MAPSRRMAAPVLVLMLLPVA--TELGTTKVAEARHYLSQSHRFKGLCMSSNNCANVCQTE  174

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  175  NFPGGECKAEGATRKCFCKKIC*  243


>LN650980.1 Zea mays mRNA for Defensin protein (Defensin gene), cultivar 
Laocai
 LN650982.1 Zea mays mRNA for Defensin protein (Defensin gene), cultivar 
Maison
Length=243

 Score = 85.5 bits (210),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VLLLLL+   TE+GT K AEAR CLSQSH+FKG C+S++NCA  C+TE
Sbjct  1    MAPSRRMAAPVLVLLLLLVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANACQTE  174

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  175  NFPGGECKAEGATRKCFCKKIC*  243


>EF557689.1 Oryza sativa (indica cultivar-group) clone IR62266_5F.z1 genomic 
sequence
Length=271

 Score = 85.5 bits (210),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCY  77
            EMGT K AEAR CLSQSH+FKG C++ +NCA VCRTE+FPDGEC +H +ERKC+
Sbjct  108  EMGTTKVAEARHCLSQSHRFKGMCVTGNNCANVCRTESFPDGECKSHGLERKCF  269


>GQ449374.1 Triticum turgidum subsp. durum defensin precursor (PRPI-10) gene, 
complete cds
Length=2170

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 50/62 (81%), Gaps = 2/62 (3%)
 Frame = +2

Query  24    EMG--TMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRT  81
             EMG  T K AEAR C+SQSH FKG CLS+SNC AVCRTENFPDGEC+T   ERKC+CKR 
Sbjct  1985  EMGATTTKVAEARDCVSQSHNFKGACLSSSNCPAVCRTENFPDGECHTPHFERKCFCKRP  2164

Query  82    C*  83
             C*
Sbjct  2165  C*  2170


>LN809934.1 Zea mays Defensin gene, cultivar MaiSon
Length=345

 Score = 85.5 bits (210),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            E+GT K AEAR CLSQSH+FKG C+S+SNCA VC+TENFP GEC      RKC+CK+ C*
Sbjct  166  ELGTTKVAEARHCLSQSHRFKGLCMSSSNCANVCQTENFPGGECKAEGATRKCFCKKIC*  345


>KJ551526.1 Triticum aestivum cultivar Chinese Spring defensin (PDF11) mRNA, 
complete cds
Length=589

 Score = 87.8 bits (216),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +2

Query  23   TEMGT--MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMGT   K AEAR CLS+SHKFKG CLS+SNCA++CRTENFP GEC      RKC+CKR
Sbjct  107  TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  286

Query  81   TC  82
             C
Sbjct  287  VC  292


>XM_004953118.3 PREDICTED: Setaria italica defensin Tm-AMP-D1.2-like (LOC101754239), 
mRNA
Length=689

 Score = 88.6 bits (218),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   V LLLL+   +EMG    AEAR CLSQSH FKG CLS+SNCA VCR E
Sbjct  128  MALSRRMAAPVLVFLLLLIA--SEMGPATVAEARHCLSQSHHFKGLCLSSSNCANVCRVE  301

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
             FPDGEC T    RKC+CKR C*
Sbjct  302  RFPDGECQTTAGTRKCFCKRIC*  370


>GQ449375.1 Triticum turgidum subsp. durum defensin precursor (PRPI-11) gene, 
complete cds
Length=3584

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +1

Query  23    TEMGT--MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
              EMGT  MK AEAR CLSQSHKFKG+CLS+SNCA++CRTENFP GEC      RKC+CKR
Sbjct  3160  AEMGTPTMKAAEARDCLSQSHKFKGSCLSSSNCASICRTENFPGGECKLESFARKCFCKR  3339

Query  81    TC  82
              C
Sbjct  3340  VC  3345


>EU958657.1 Zea mays clone 1708375 low-molecular-weight cysteine-rich protein 
LCR69 precursor, mRNA, complete cds
Length=579

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TENFP GEC      RKC+CK+ C
Sbjct  99   TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGECKAEGATRKCFCKKIC  278

Query  83   *  83
            *
Sbjct  279  *  281


>LN650979.1 Zea mays mRNA for Defensin protein (Defensin gene), cultivar 
CP888
Length=243

 Score = 84.0 bits (206),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VLLLLL+   TE+GT K AEAR  LSQSH+FKG C+S++NCA VC+TE
Sbjct  1    MAPSRRMAAPVLVLLLLLVA--TELGTTKVAEARHYLSQSHRFKGLCMSSNNCANVCQTE  174

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  175  NFPGGECKAEGATRKCFCKKIC*  243


>BT009167.1 Triticum aestivum clone wl1n.pk0096.c8:fis, full insert mRNA 
sequence
Length=630

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA T R   A A++ LL+LL A+EMGT + AEAR C SQSH+F G C+S SNC  VCRTE
Sbjct  102  MAWTSRRMVASALVFLLMLLAASEMGTTRVAEARHCTSQSHRFVGACMSKSNCENVCRTE  281

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
             FP GEC  H +ERKC+CKR C*
Sbjct  282  GFPWGECRWHGIERKCHCKRIC*  350


>EU952901.1 Zea mays clone 1336370 low-molecular-weight cysteine-rich protein 
LCR69 precursor, mRNA, complete cds
Length=548

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TENFP GEC      RKC+CK+ C
Sbjct  66   TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGECKAEGATRKCFCKKIC  245

Query  83   *  83
            *
Sbjct  246  *  248


>EU958628.1 Zea mays clone 1706440 low-molecular-weight cysteine-rich protein 
LCR69 precursor, mRNA, complete cds
Length=506

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LLL+   TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  68   MALSRRMAAPVLVLMLLLVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  241

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  242  NFPGGECKAEGATRKCFCKKIC*  310


>NM_001155758.2 Zea mays uncharacterized LOC100282852 (pco090777), mRNA
Length=695

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA T R   A A++ LL+LL A+EMGT + AEAR C SQSH+F G C+S SNC  VCRTE
Sbjct  116  MAWTSRRMVASALVFLLMLLAASEMGTTRVAEARHCTSQSHRFVGACMSKSNCENVCRTE  295

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
             FP GEC  H +ERKC+CKR C*
Sbjct  296  GFPWGECRWHGIERKCHCKRIC*  364


>EU962530.1 Zea mays clone 243478 low-molecular-weight cysteine-rich protein 
LCR70 precursor, mRNA, complete cds
Length=681

 Score = 87.0 bits (214),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA T R   A A++ LL+LL A+EMGT + AEAR C SQSH+F G C+S SNC  VCRTE
Sbjct  102  MAWTSRRMVASALVFLLMLLAASEMGTTRXAEARHCTSQSHRFVGACMSKSNCENVCRTE  281

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
             FP GEC  H +ERKC+CKR C*
Sbjct  282  GFPWGECRWHGIERKCHCKRIC*  350


>EU958634.1 Zea mays clone 1706684 low-molecular-weight cysteine-rich protein 
LCR69 precursor, mRNA, complete cds
Length=557

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TENFP GEC      RKC+CK+ C
Sbjct  128  TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGECRAEGATRKCFCKKIC  307

Query  83   *  83
            *
Sbjct  308  *  310


>XM_002452439.1 Sorghum bicolor hypothetical protein, mRNA
Length=552

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TE+GT   AEAR CLSQSH+FKG C+S++NCA VC+TENFP GEC      RKC+CK+ C
Sbjct  114  TELGTTPVAEARHCLSQSHRFKGLCMSSTNCANVCQTENFPGGECKAEGATRKCFCKKIC  293

Query  83   *  83
            *
Sbjct  294  *  296


>AY109044.1 Zea mays PCO090777 mRNA sequence
Length=796

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA T R   A A++ LL+LL A+EMGT + AEAR C SQSH+F G C+S SNC  VCRTE
Sbjct  117  MAWTSRRMVASALVFLLMLLAASEMGTTRVAEARHCTSQSHRFVGACMSKSNCENVCRTE  296

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
             FP GEC  H +ERKC+CKR C*
Sbjct  297  GFPWGECRWHGIERKCHCKRIC*  365


>BT009185.1 Triticum aestivum clone wl1n.pk0135.h12:fis, full insert mRNA 
sequence
Length=628

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LLL+   TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  127  MALSRRMAAPVLVLMLLLVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  300

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  301  NFPGGECKAEGATRKCFCKKIC*  369


>AK224369.1 Oryza officinalis cDNA, clone: CCP06G10, expressed in panicle 
of CC genome
Length=602

 Score = 85.9 bits (211),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +3

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRM A+  +LL +L+   TEMGT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  63   MAPSRRMVASVFLLLAILVA--TEMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCKTE  236

Query  61   NFPDGECNTHLVER  74
            +FPDGEC +H +ER
Sbjct  237  SFPDGECKSHGLER  278


>XM_004976203.2 PREDICTED: Setaria italica defensin Tk-AMP-D1-like (LOC101763991), 
mRNA
Length=504

 Score = 85.1 bits (209),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            +EMGT + AEAR CLSQSHKF G C+S  NC  VC TE FP G C  H +ERKCYCKR C
Sbjct  147  SEMGTTRVAEARHCLSQSHKFVGACMSYRNCEGVCNTEGFPWGVCRWHGMERKCYCKRLC  326

Query  83   *  83
            *
Sbjct  327  *  329


>AY108568.1 Zea mays PCO111219 mRNA sequence
Length=647

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +3

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LLL+   TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  138  MALSRRMAAPVLVLMLLLVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  311

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  312  NFPGGECKAEGATRKCFCKKIC*  380


>GQ449373.1 Triticum turgidum subsp. durum defensin precursor (PRPI-1) gene, 
complete cds
Length=3751

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  27    TMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
             T K AEAR CLSQS KFKG CLS+SNCAAVCRTE FPDGEC+   +ERKC+CKR C*
Sbjct  3321  TTKVAEARDCLSQSFKFKGACLSSSNCAAVCRTEKFPDGECHRQHLERKCFCKRPC*  3491


>EU957417.1 Zea mays clone 1591261 low-molecular-weight cysteine-rich protein 
LCR69 precursor, mRNA, complete cds
Length=677

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LLL+   TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  143  MALSRRMAAPVLVLMLLLVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  316

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  317  NFPGGECKAEGATRKCFCKKIC*  385


>EU961911.1 Zea mays clone 238984 low-molecular-weight cysteine-rich protein 
LCR69 precursor, mRNA, complete cds
Length=686

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LLL+   TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  149  MALSRRMAAPVLVLMLLLVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  322

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  323  NFPGGECKAEGATRKCFCKKIC*  391


>DQ244829.1 Zea mays clone 11039 mRNA sequence
Length=687

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LLL+   TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  146  MALSRRMAAPVLVLMLLLVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  319

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  320  NFPGGECKAEGATRKCFCKKIC*  388


>CT833840.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA016O11, 
full insert sequence
Length=598

 Score = 85.5 bits (210),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +3

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRM A+  +LL +L+   TEMGT K AEAR CLSQSH+FKG C+S++NCA VCRTE
Sbjct  87   MAPSRRMVASAFLLLAILVA--TEMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTE  260

Query  61   NFPDGECNTHLVER  74
            +FPDGEC +H +ER
Sbjct  261  SFPDGECKSHGLER  302


>AK121915.1 Oryza sativa Japonica Group cDNA clone:J033106C08, full insert 
sequence
Length=603

 Score = 85.5 bits (210),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRM A+  +LL +L+   TEMGT K AEAR CLSQSH+FKG C+S++NCA VCRTE
Sbjct  89   MAPSRRMVASAFLLLAILVA--TEMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTE  262

Query  61   NFPDGECNTHLVER  74
            +FPDGEC +H +ER
Sbjct  263  SFPDGECKSHGLER  304


>NM_001153529.1 Zea mays uncharacterized LOC100280611 (pco111219a), mRNA
 EU971801.1 Zea mays clone 370802 low-molecular-weight cysteine-rich protein 
LCR69 precursor, mRNA, complete cds
Length=724

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRMAA   VL+LLL+   TE+GT K AEAR CLSQSH+FKG C+S++NCA VC+TE
Sbjct  146  MALSRRMAAPVLVLMLLLVA--TELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTE  319

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
            NFP GEC      RKC+CK+ C*
Sbjct  320  NFPGGECKAEGATRKCFCKKIC*  388


>XM_015768577.1 PREDICTED: Oryza sativa Japonica Group defensin Tm-AMP-D1.2 (LOC4330051), 
mRNA
Length=638

 Score = 85.5 bits (210),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA +RRM A+  +LL +L+   TEMGT K AEAR CLSQSH+FKG C+S++NCA VCRTE
Sbjct  91   MAPSRRMVASAFLLLAILVA--TEMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTE  264

Query  61   NFPDGECNTHLVER  74
            +FPDGEC +H +ER
Sbjct  265  SFPDGECKSHGLER  306


>EU944119.1 Zea mays clone 1708720 mRNA sequence
Length=546

 Score = 84.3 bits (207),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            ++GT K AEAR CLSQSH+FKG C+S++NCA VC+TENFP GEC      RKC+CK+ C*
Sbjct  122  QLGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGECKAEGATRKCFCKKIC*  301


>LN878138.1 Zea mays defensin pseudogene, cultivar LVN99
 LN890279.1 Zea mays defensin gene intron, cultivar LVN99
Length=345

 Score = 82.4 bits (202),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            E+GT K AEAR  LSQSH+FKG C+S+SNCA VC+TENFP GEC      RKC+CK+ C*
Sbjct  166  ELGTTKVAEARHYLSQSHRFKGLCMSSSNCANVCQTENFPGGECKAEGATRKCFCKKIC*  345


>XM_015836489.1 PREDICTED: Oryza brachyantha defensin Tk-AMP-D1-like (LOC107304115), 
mRNA
Length=252

 Score = 80.9 bits (198),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            + ++RRM A   + LL+LL+VA+E GT + AEAR C+SQSH+F G C+  SNC  VC TE
Sbjct  4    VPTSRRMVAPVLLFLLILLVVASETGTARVAEARHCVSQSHRFVGACMRKSNCEHVCITE  183

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
             FP GEC  H VERKC+CK+ C*
Sbjct  184  GFPWGECRFHGVERKCFCKKRC*  252


>GQ449378.1 Triticum turgidum subsp. durum defensin precursor (PRPI-8) gene, 
complete cds
Length=3782

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +3

Query  24    EMGTM--KTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRT  81
             EMGT   K AEAR CLSQSH FKG CLS+SNCA VC TE+FP GEC+T   ERKC+CKR 
Sbjct  3168  EMGTTTTKLAEARDCLSQSHNFKGACLSSSNCAGVCHTESFPGGECHTQHFERKCFCKRP  3347

Query  82    C*  83
             C*
Sbjct  3348  C*  3353


>XM_004976204.1 PREDICTED: Setaria italica defensin Tk-AMP-D2-like (LOC101764403), 
mRNA
Length=469

 Score = 82.0 bits (201),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            +E+G  + AEAR C+SQSHKF+GTC   SNC  VC+TE FP GEC  H + RKCYCKR C
Sbjct  117  SEIGPTRVAEARHCVSQSHKFEGTCTRKSNCENVCKTEGFPWGECKWHGIVRKCYCKRLC  296

Query  83   *  83
            *
Sbjct  297  *  299


>EU965804.1 Zea mays clone 289072 hypothetical protein mRNA, complete cds
Length=805

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            E+GT K AEAR CLSQSH+FKG C+S++NCA VC+TENFP GEC      RKC+CK+ C*
Sbjct  330  ELGTTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGECKAEGATRKCFCKKIC*  509


>EU969138.1 Zea mays clone 326270 low-molecular-weight cysteine-rich protein 
LCR70 precursor, mRNA, complete cds
Length=675

 Score = 83.2 bits (204),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  1    MASTRRMaaapavlllllllvaTEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTE  60
            MA T R   A A++ LL+LL A+EMGT + AEAR C SQSH+F G C+S SNC  VCRTE
Sbjct  92   MAWTSRRMVASALVFLLMLLAASEMGTTRVAEARHCTSQSHRFVGACMSKSNCENVCRTE  271

Query  61   NFPDGECNTHLVERKCYCKRTC*  83
             FP  EC  H +ERKC CKR C*
Sbjct  272  GFPWXECRWHGIERKCXCKRIC*  340


>XM_015780888.1 PREDICTED: Oryza sativa Japonica Group defensin Tk-AMP-D1-like 
(LOC107277757), mRNA
Length=590

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            +EMGT + AEAR C+SQSH+F G C+  SNC  VC TE FP GEC  H +ERKC+CK+ C
Sbjct  161  SEMGTTRVAEARHCVSQSHRFVGACMRKSNCEHVCMTEGFPWGECRFHGIERKCFCKKRC  340


>XM_016096860.1 PREDICTED: Arachis duranensis defensin Ec-AMP-D2-like (LOC107476912), 
mRNA
Length=554

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG +  AEARTC SQSH+FKG CLS++NCA+VC+TE FP G+C  H   R+C+C + C
Sbjct  154  TEMGPIMVAEARTCASQSHRFKGVCLSDTNCASVCKTEGFPSGDC--HGFRRRCFCTKHC  327


>DQ099064.1 Arachis stenosperma clone AS1RN9A05 microsatellite sequence
Length=518

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG +   EARTC SQSH+FKG CLS++NCA+VC+TE FP G+C  H   R+C+C + C
Sbjct  124  TEMGPITVVEARTCASQSHRFKGVCLSDTNCASVCKTEGFPSGDC--HGFRRRCFCTKHC  297


>XM_016329551.1 PREDICTED: Arachis ipaensis defensin Ec-AMP-D2-like (LOC107626623), 
mRNA
Length=562

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG +  AE RTC SQSH+FKG CLS++NCA+VC+TE FP G+C  H   R+C+C + C
Sbjct  168  TEMGPIMVAEGRTCASQSHRFKGVCLSDTNCASVCKTEGFPSGDC--HGFRRRCFCTKHC  341


>AP006168.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1469H02
Length=136602

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  24      EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVER  74
               EMGT K AEAR CLSQSH+FKG C+S++NCA VCRTE+FPDGEC +H +ER
Sbjct  109623  EMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLER  109775


>AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, 
complete sequence
Length=35937250

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  24        EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVER  74
                 EMGT K AEAR CLSQSH+FKG C+S++NCA VCRTE+FPDGEC +H +ER
Sbjct  25190737  EMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLER  25190889


>CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence
Length=36385228

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  24        EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVER  74
                 EMGT K AEAR CLSQSH+FKG C+S++NCA VCRTE+FPDGEC +H +ER
Sbjct  25386496  EMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLER  25386648


>AK224243.1 Oryza punctata cDNA, clone: BBS18D09, expressed in shoot apical 
meristem of BB genome
Length=492

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  26   GTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVER  74
            GT K AEAR CLSQSH+FKG C+S++NCA VCRTE+FPDGEC +H +ER
Sbjct  7    GTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLER  153


>AK287660.1 Oryza sativa Japonica Group cDNA, clone: J065112B21, full insert 
sequence
Length=2723

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            +EMGT + AEAR C+SQSH+F G C+  SNC  VC TE FP GEC  H +ERKC+CK+ C
Sbjct  156  SEMGTTRVAEARHCVSQSHRFVGACMRKSNCEHVCMTEGFPWGECRFHGIERKCFCKKRC  335


>AK241145.1 Oryza sativa Japonica Group cDNA, clone: J065112B21, full insert 
sequence
Length=2722

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            +EMGT + AEAR C+SQSH+F G C+  SNC  VC TE FP GEC  H +ERKC+CK+ C
Sbjct  156  SEMGTTRVAEARHCVSQSHRFVGACMRKSNCEHVCMTEGFPWGECRFHGIERKCFCKKRC  335


>CR855210.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0131L05, 
complete sequence
Length=88580

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  23     TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
               EMGT + AEAR C+SQSH+F G C+  SNC  VC TE FP GEC  H +ERKC+CK+ C
Sbjct  67701  AEMGTTRVAEARHCVSQSHRFVGACMRKSNCEHVCMTEGFPWGECRFHGIERKCFCKKRC  67880


>AL662958.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0019D11, 
complete sequence
Length=163039

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  23      TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
                EMGT + AEAR C+SQSH+F G C+  SNC  VC TE FP GEC  H +ERKC+CK+ C
Sbjct  128373  AEMGTTRVAEARHCVSQSHRFVGACMRKSNCEHVCMTEGFPWGECRFHGIERKCFCKKRC  128552


>CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence
Length=32587158

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  23        TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
                  EMGT + AEAR C+SQSH+F G C+  SNC  VC TE FP GEC  H +ERKC+CK+ C
Sbjct  23141107  AEMGTTRVAEARHCVSQSHRFVGACMRKSNCEHVCMTEGFPWGECRFHGIERKCFCKKRC  23141286


>AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, 
complete sequence
Length=35502694

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  23        TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
                  EMGT + AEAR C+SQSH+F G C+  SNC  VC TE FP GEC  H +ERKC+CK+ C
Sbjct  26120602  AEMGTTRVAEARHCVSQSHRFVGACMRKSNCEHVCMTEGFPWGECRFHGIERKCFCKKRC  26120781


>XM_016645980.1 PREDICTED: Nicotiana tabacum defensin-like protein (LOC107819830), 
mRNA
Length=336

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG +  AEAR C SQS +FKG C+SN NCA+VC TE FPDG+C    + R+C+C R C
Sbjct  118  TEMGPIMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKG--LRRRCFCLRNC  291

Query  83   *  83
            *
Sbjct  292  *  294


>FP095070.1 Phyllostachys edulis cDNA clone: bphyst015o17, full insert sequence
Length=623

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            EMGT + AEAR C+SQSH+F G C+   NCA VC TE F  GEC  H +ERKC+CK+ C*
Sbjct  165  EMGTTRVAEARHCVSQSHRFVGACMRERNCAHVCNTEGFTSGECRFHGIERKCFCKKRC*  344


>EF557459.1 Oryza sativa (indica cultivar-group) clone IR42253_5F.z1 genomic 
sequence
Length=244

 Score = 73.6 bits (179),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGEC  67
            EMGT K AEAR CLSQSH+FKG C++++NCA VCRTE+FPDGEC
Sbjct  108  EMGTTKVAEARHCLSQSHRFKGMCVTSNNCANVCRTESFPDGEC  239


>EF557975.1 Oryza sativa (indica cultivar-group) clone N22B_51FSF.z1 genomic 
sequence
Length=171

 Score = 72.4 bits (176),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGE  66
            EMGT K AEAR CLSQSH+FKG C+S++NCA VCRTE+FPDGE
Sbjct  41   EMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGE  169


>XM_009770613.1 PREDICTED: Nicotiana sylvestris defensin-like protein (LOC104219866), 
transcript variant X2, mRNA
Length=519

 Score = 75.1 bits (183),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG +  AEAR C SQS +FKG C+SN NCA+VC TE FPDG+C    + R+C+C R C
Sbjct  126  TEMGPIMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKG--LRRRCFCLRNC  299

Query  83   *  83
            *
Sbjct  300  *  302


>XM_009601061.1 PREDICTED: Nicotiana tomentosiformis defensin-like protein (LOC104095022), 
mRNA
Length=354

 Score = 73.2 bits (178),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M +AEARTC SQSH+F GTC+ +SNCA++C+TE F  G C      R+C+C R C
Sbjct  74   TEMGQMSSAEARTCESQSHRFHGTCVRDSNCASICQTEGFIGGNCRG--FRRRCFCTRNC  247

Query  83   *  83
            *
Sbjct  248  *  250


>XM_003629284.2 Medicago truncatula Defensin MtDef4.5 mRNA
Length=325

 Score = 72.8 bits (177),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG++   EAR CLSQSH FKG CLS+ NCA VC TE F DG C      ++C+C + C
Sbjct  83   TEMGSIMVVEARKCLSQSHSFKGLCLSDQNCATVCLTEGFTDGRCRGF--RQRCFCSKPC  256


>AY498565.1 Capsicum annuum defensin precursor mRNA, complete cds
Length=398

 Score = 73.2 bits (178),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M+  EARTC SQSH+FKG C S +NCA+VC+TE F  G+C      R+C+C R C
Sbjct  67   TEMGPMRIVEARTCESQSHRFKGVCASETNCASVCQTEGFSGGDCRGF--RRRCFCTRPC  240

Query  83   *  83
            *
Sbjct  241  *  243


>XM_006359424.1 PREDICTED: Solanum tuberosum defensin-like protein (LOC102604459), 
mRNA
Length=405

 Score = 72.8 bits (177),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            +EMGTM +AEARTC SQS++FKGTC+ +SNCA VC+TE F  G C      R+C+C R C
Sbjct  103  SEMGTMSSAEARTCESQSNRFKGTCVRDSNCATVCQTEGFIGGNCRG--FRRRCFCTRNC  276

Query  83   *  83
            *
Sbjct  277  *  279


>XM_016608527.1 PREDICTED: Nicotiana tabacum defensin-like protein (LOC107787010), 
mRNA
Length=424

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M +AEARTC SQSH+F GTC+  SNCA+VC+TE F  G C    + R+C+C R C
Sbjct  123  TEMGPMSSAEARTCESQSHRFHGTCVRGSNCASVCQTEGFIGGNCRG--LRRRCFCTRNC  296

Query  83   *  83
            *
Sbjct  297  *  299


>XM_009804353.1 PREDICTED: Nicotiana sylvestris defensin-like protein (LOC104248150), 
mRNA
Length=423

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M +AEARTC SQSH+F GTC+  SNCA+VC+TE F  G C    + R+C+C R C
Sbjct  122  TEMGPMSSAEARTCESQSHRFHGTCVRGSNCASVCQTEGFIGGNCRG--LRRRCFCTRNC  295

Query  83   *  83
            *
Sbjct  296  *  298


>AY695796.1 Ginkgo biloba defensin precursor, mRNA, complete cds
Length=534

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  29   KTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            + AEARTC +QS KFKG CLS++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  148  EVAEARTCKTQSSKFKGYCLSDTNCRNVCRTEGFPTGSCDFHVASRKCYCYKPC  309


>XM_009616372.1 PREDICTED: Nicotiana tomentosiformis defensin-like protein (LOC104107541), 
mRNA
Length=582

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG +  AEAR C SQS +FKG C+SN NCA+VC TE FPDG+C    + R+C+C R C
Sbjct  147  TEMGPVMVAEARNCESQSERFKGVCVSNRNCASVCNTEGFPDGKCKG--LRRRCFCLRNC  320

Query  83   *  83
            *
Sbjct  321  *  323


>DQ244495.1 Zea mays clone 8537 mRNA sequence
Length=596

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 4/65 (6%)
 Frame = +2

Query  23   TEMGTMKTAEART----CLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYC  78
            TEMGTM+ AEAR     C SQSH+++G C  + NC  VC TE FP G+C  H  ERKC+C
Sbjct  161  TEMGTMRVAEARHGHRHCESQSHRYRGACWRDDNCEHVCNTEGFPWGKCKFHDFERKCFC  340

Query  79   KRTC*  83
            K+ C*
Sbjct  341  KKPC*  355


>KX688721.1 Nicotiana alata class I defensin mRNA, complete cds
Length=240

 Score = 71.2 bits (173),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C  +SNCA VC TE F  G+C      R+C+C R C
Sbjct  61   TEMGPMTIAEARTCESQSHRFKGPCARDSNCATVCLTEGFSGGDCRGF--RRRCFCTRPC  234

Query  83   *  83
            *
Sbjct  235  *  237


>XM_016578132.1 PREDICTED: Nicotiana tabacum defensin-like protein (LOC107760114), 
mRNA
Length=414

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M +AEARTC SQSH+F GTC+ +SNCA++C+TE F  G C      R+C+C R C
Sbjct  134  TEMGQMSSAEARTCESQSHRFHGTCVRDSNCASICQTEGFIGGNCRG--FRRRCFCTRNC  307

Query  83   *  83
            *
Sbjct  308  *  310


>XM_016700063.1 PREDICTED: Capsicum annuum defensin Ec-AMP-D1-like (LOC107855074), 
mRNA
Length=629

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M+  EARTC SQSH+FKG C+S +NCA+VC+TE F  G+C      R+C+C R C
Sbjct  223  TEMGPMRIVEARTCESQSHRFKGACVSETNCASVCQTEGFSGGDCRG--FRRRCFCTRPC  396

Query  83   *  83
            *
Sbjct  397  *  399


>EF421192.1 Nelumbo nucifera defensin mRNA, complete cds
Length=561

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG  K AEARTC SQSH+FKG CLS++NCA+VC+TE FP G+C      R+C+C + C
Sbjct  130  TEMGP-KVAEARTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKG--ARRRCFCVKPC  300

Query  83   *  83
            *
Sbjct  301  *  303


>XM_009770612.1 PREDICTED: Nicotiana sylvestris defensin-like protein (LOC104219866), 
transcript variant X1, mRNA
Length=523

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +3

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            EMG +  AEAR C SQS +FKG C+SN NCA+VC TE FPDG+C    + R+C+C R C*
Sbjct  132  EMGPIMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKG--LRRRCFCLRNC*  305


>XM_010272475.1 PREDICTED: Nelumbo nucifera defensin-like protein (LOC104606994), 
mRNA
Length=541

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG  K AEARTC SQSH+FKG CLS++NCA+VC+TE FP G+C      R+C+C + C
Sbjct  121  TEMGP-KVAEARTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKG--ARRRCFCVKPC  291

Query  83   *  83
            *
Sbjct  292  *  294


>EF506491.1 Olea europaea putative defensin protein 1 mRNA, partial cds
Length=357

 Score = 71.6 bits (174),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = +2

Query  26   GTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            G +  A+ARTC SQSH+FKG+C+S SNCAAVC+TE FPDG C      R+C+C + C*
Sbjct  5    GPLMVADARTCESQSHRFKGSCVSKSNCAAVCQTEGFPDGYCRG--FRRRCFCSKHC*  172


>FJ623460.1 Jatropha curcas low-molecular-weight cysteine-rich 69 mRNA, complete 
cds
Length=234

 Score = 70.1 bits (170),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TE+G+ K AEARTC SQSHKFKGTCLS +NCA VC+TE F  G+C    + R+C+C R C
Sbjct  61   TEIGS-KMAEARTCESQSHKFKGTCLSETNCANVCKTEGFTGGDCRG--LRRRCFCTRHC  231

Query  83   *  83
            *
Sbjct  232  *  234


>XM_004976202.2 PREDICTED: Setaria italica defensin-like protein (LOC101763590), 
mRNA
Length=532

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +1

Query  1    MASTRRMaaapavlllllllvaTEMGTMK-TAEARTCLSQSHKFKGTCLSNSNCAAVCRT  59
            MAST R AAAP +  LLLLLVA+EMGT +  AEAR C+SQSHKF G+C+  SNC  VC+T
Sbjct  154  MASTSRRAAAPVLFFLLLLLVASEMGTTRPVAEARRCVSQSHKFVGSCMRKSNCQHVCQT  333

Query  60   ENFPDGECNTH-LVERKCYCKRTC*  83
            E FP GEC  H  + R+C+C + C*
Sbjct  334  EGFPWGECRFHGGLLRRCFCNKLC*  408


>BT117945.1 Picea glauca clone GQ03918_C16 mRNA sequence
Length=501

 Score = 72.0 bits (175),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEARTC + S KFKG C+S++NC +VCRTE FP G C+ H+  RKCYC + C
Sbjct  142  MMQVEMAEARTCKTPSGKFKGYCVSSTNCKSVCRTEGFPSGSCDFHVAGRKCYCYKPC  315


>XM_014652387.1 PREDICTED: Vigna radiata var. radiata defensin Ec-AMP-D2-like 
(LOC106767483), mRNA
Length=525

 Score = 72.0 bits (175),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG    AEARTC SQSH+FKG C+SN+NCA+VCRTE F  G C      R+C+C + C
Sbjct  125  TEMGPTMVAEARTCESQSHRFKGPCVSNTNCASVCRTERFTGGHCRG--FRRRCFCTKHC  298

Query  83   *  83
            *
Sbjct  299  *  301


>AF442388.1 Capsicum annuum defensin protein precursor, mRNA, complete cds
Length=512

 Score = 72.0 bits (175),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M+  EARTC SQSH+FKG C S +NCA+VC+TE F  G+C      R+C+C R C
Sbjct  92   TEMGPMRIVEARTCESQSHRFKGVCASETNCASVCQTEGFSGGDCRG--FRRRCFCTRPC  265

Query  83   *  83
            *
Sbjct  266  *  268


>JN980401.1 Pinus sylvestris defensin 3 (Def3) mRNA, complete cds
Length=252

 Score = 69.7 bits (169),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AE R C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  73   MMAVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPSGSCDFHVTSRKCYCYKPC  246


>FJ489605.1 Jatropha curcas defensin mRNA, complete cds
Length=234

 Score = 68.9 bits (167),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TE+G+ K AEARTC SQ+HKFKGTCLS +NCA VC+TE F  G+C    + R+C+C R C
Sbjct  61   TEIGS-KMAEARTCESQTHKFKGTCLSETNCANVCKTEGFTGGDCRG--LRRRCFCTRHC  231

Query  83   *  83
            *
Sbjct  232  *  234


>GQ449376.1 Triticum turgidum subsp. durum defensin precursor (PRPI-5) gene, 
complete cds
Length=3223

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 4/65 (6%)
 Frame = +2

Query  23    TEMGTMKTAEART----CLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYC  78
              EMGTM+ AEAR     C SQSH+++G C  + NC  VC TE FP G+C  H  ERKC+C
Sbjct  3029  AEMGTMRVAEARHGHRHCESQSHRYRGACWRDDNCEHVCNTEGFPWGKCKFHDFERKCFC  3208

Query  79    KRTC*  83
             KR C*
Sbjct  3209  KRPC*  3223


>EF455616.1 Pinus sylvestris defensin (Def1) mRNA, complete cds
Length=252

 Score = 68.9 bits (167),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AE R C + S KFKG C++N+NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  73   MMQVQVAEGRMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPC  246


>XM_012222860.1 PREDICTED: Jatropha curcas defensin-like protein (LOC105638945), 
mRNA
Length=417

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TE+G+ K AEARTC SQSHKFKGTCLS +NCA VC+TE F  G+C    + R+C+C R C
Sbjct  125  TEIGS-KMAEARTCESQSHKFKGTCLSETNCANVCKTEGFTGGDCRG--LRRRCFCTRHC  295

Query  83   *  83
            *
Sbjct  296  *  298


>NM_001310318.1 Solanum lycopersicum defensin-like protein (LOC101263224), mRNA
Length=394

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG + +AEARTC SQS+ FKGTC+ +SNCA VC+TE F  G C      R+C+C R C
Sbjct  97   TEMGPISSAEARTCESQSNSFKGTCVRDSNCATVCQTEGFIGGNCRGF--RRRCFCTRNC  270

Query  83   *  83
            *
Sbjct  271  *  273


>XM_015226386.1 PREDICTED: Solanum pennellii defensin-like protein (LOC107025619), 
mRNA
Length=373

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG + +AEARTC SQS+ FKGTC+ +SNCA VC+TE F  G C      R+C+C R C
Sbjct  88   TEMGPISSAEARTCESQSNSFKGTCVRDSNCATVCQTEGFIGGNCRGF--RRRCFCTRNC  261

Query  83   *  83
            *
Sbjct  262  *  264


>EF455617.1 Pinus sylvestris defensin (Def2) mRNA, complete cds
Length=252

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AE R C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  73   MMEVQVAEGRMCKTPSAKFKGYCVSSTNCKNVCRTEGFPTGSCDFHITSRKCYCYKPC  246


>JX576265.1 Solanum tuberosum clone St-DNT109 protease inhibitor-related 
protein mRNA, complete cds
Length=237

 Score = 68.2 bits (165),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M+ AEAR C S SH+FKG C  +SNCA+VC TE F  G C  H   R+C+C + C
Sbjct  61   TEMGPMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNC--HGFRRRCFCTKPC  234

Query  83   *  83
            *
Sbjct  235  *  237


>XM_007156329.1 Phaseolus vulgaris hypothetical protein (PHAVU_003G282500g) mRNA, 
complete cds
Length=507

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG    AEARTC SQSH+FKG C+S++NCA+VCRTE F  G C      R+C+C + C
Sbjct  111  TEMGPRMVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRG--FRRRCFCTKHC  284

Query  83   *  83
            *
Sbjct  285  *  287


>XM_009594998.1 PREDICTED: Nicotiana tomentosiformis defensin-like protein P322 
(LOC104089972), mRNA
Length=516

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C  +SNCA VC TE F  G+C      R+C+C R C
Sbjct  131  TEMGPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGF--RRRCFCTRPC  304

Query  83   *  83
            *
Sbjct  305  *  307


>KJ788079.1 Solanum tuberosum clone PI4341 defensin-like protein mRNA, complete 
cds
Length=276

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M+ AEAR C S SH+FKG C  +SNCA+VC TE F  G C  H   R+C+C + C
Sbjct  100  TEMGPMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNC--HGFRRRCFCTKPC  273

Query  83   *  83
            *
Sbjct  274  *  276


>XM_016594790.1 PREDICTED: Nicotiana tabacum defensin-like protein P322 (LOC107775109), 
mRNA
Length=547

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C  +SNCA VC TE F  G+C      R+C+C R C
Sbjct  155  TEMGPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRG--FRRRCFCTRPC  328

Query  83   *  83
            *
Sbjct  329  *  331


>KJ601732.1 Pinus sylvestris defensin 4 mRNA, complete cds
Length=252

 Score = 68.2 bits (165),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AE R C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  73   MMEVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  246


>XM_009771541.1 PREDICTED: Nicotiana sylvestris defensin-like protein P322 (LOC104220646), 
mRNA
Length=536

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C  +SNCA VC TE F  G+C      R+C+C R C
Sbjct  146  TEMGPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRG--FRRRCFCTRPC  319

Query  83   *  83
            *
Sbjct  320  *  322


>KJ788076.1 Solanum tuberosum clone PI1733 defensin-like protein mRNA, complete 
cds
Length=261

 Score = 68.2 bits (165),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M+ AEAR C S SH+FKG C  +SNCA+VC TE F  G C  H   R+C+C + C
Sbjct  85   TEMGPMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNC--HGFRRRCFCTKPC  258

Query  83   *  83
            *
Sbjct  259  *  261


>AY494051.1 Picea glauca defensin mRNA, complete cds
Length=422

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEARTC + S KFKG C S++NC  VC+TE FP G C+ H+  RKCYC + C
Sbjct  78   MMQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  251


>JQ654634.1 Nicotiana tabacum defensin (DEF1) mRNA, complete cds
Length=538

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C  +SNCA VC TE F  G+C      R+C+C R C
Sbjct  139  TEMGPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRG--FRRRCFCTRPC  312

Query  83   *  83
            *
Sbjct  313  *  315


>XM_016595723.1 PREDICTED: Nicotiana tabacum defensin-like protein P322 (LOC107775918), 
mRNA
Length=588

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C  +SNCA VC TE F  G+C      R+C+C R C
Sbjct  191  TEMGPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGF--RRRCFCTRPC  364

Query  83   *  83
            *
Sbjct  365  *  367


>XM_004954757.2 PREDICTED: Setaria italica defensin Tm-AMP-D1.2-like (LOC101763028), 
mRNA
Length=651

 Score = 70.9 bits (172),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  30   TAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
             +E R CLSQSH FKG C S+ NCA+VC++E FP G+C  H   RKC+CK  C*
Sbjct  141  VSEERHCLSQSHTFKGLCFSSENCASVCKSEKFPGGQCQMHGASRKCFCKVVC*  302


>EF678104.1 Picea sitchensis clone WS02822_J18 unknown mRNA
Length=529

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEARTC + S KFKG C S++NC  VC+TE FP G C+ H+  RKCYC + C
Sbjct  131  MIQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  304


>EF084177.1 Picea sitchensis clone WS0291_B05 unknown mRNA
Length=540

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEARTC + S KFKG C S++NC  VC+TE FP G C+ H+  RKCYC + C
Sbjct  149  MIQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  322


>AF322914.1 Elaeis guineensis defensin EGAD1 mRNA, complete cds
Length=535

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            +EMGT K AEARTC SQSHKF+GTCL  SNCA VC+TE F  G C    V R+C+C R C
Sbjct  96   SEMGT-KVAEARTCESQSHKFQGTCLRESNCANVCQTEGFQGGVCRG--VRRRCFCTRLC  266

Query  83   *  83
            *
Sbjct  267  *  269


>AB034956.1 Nicotiana tabacum mRNA for thionin like protein, complete cds
Length=612

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C  +SNCA VC TE F  G+C      R+C+C R C
Sbjct  220  TEMGPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGF--RRRCFCTRPC  393

Query  83   *  83
            *
Sbjct  394  *  396


>U72942.2 Oryza sativa proteinase inhibitor (RPI) mRNA, complete cds
Length=403

 Score = 68.9 bits (167),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  26   GTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            G +  AEARTC SQSH+FKG C   +NCA+VC TE FPDG C  H V R+C C + C
Sbjct  104  GPVMVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYC--HGVRRRCMCTKPC  268


>BT070283.1 Picea sitchensis clone WS02717_A13 unknown mRNA
Length=525

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEAR C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  141  MMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  314


>EF083702.1 Picea sitchensis clone WS0295_K17 unknown mRNA
Length=532

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEAR C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  149  MMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  322


>XM_002468536.1 Sorghum bicolor hypothetical protein, mRNA
Length=612

 Score = 70.5 bits (171),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYC  78
            TE+G +  AEARTC SQSH+F+G C+   NCA VCRTE FPDG+C      R+C+C
Sbjct  83   TEIGAVAVAEARTCQSQSHRFRGPCVRRENCANVCRTEGFPDGKCRG--FRRRCFC  244


>BT104530.1 Picea glauca clone GQ02811_I12 mRNA sequence
Length=532

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEAR C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  137  MMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  310


>FQ387342.1 Vitis vinifera clone SS0AEB26YN04
Length=519

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  S+CAAVC+TE F  G C      R+C+C R C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSDCAAVCQTEGFHGGNCRGF--RRRCFCTRHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>EF084074.1 Picea sitchensis clone WS0272_A04 unknown mRNA
Length=571

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEARTC + S KFKG C S++NC  VC+TE FP G C+ H+  RKCYC + C
Sbjct  133  MIQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  306


>BT070598.1 Picea sitchensis clone WS02738_P08 unknown mRNA
Length=539

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEAR C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  143  MMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  316


>FQ384899.1 Vitis vinifera clone SS0AEB4YB02
Length=501

 Score = 69.3 bits (168),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>XM_017573059.1 PREDICTED: Vigna angularis defensin Ec-AMP-D2-like (LOC108336583), 
mRNA
Length=532

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG    AEARTC SQSH+FKG C+S++NCA+VCRTE F  G C      R+C+C + C
Sbjct  134  TEMGPTMVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRG--FRRRCFCTKHC  307

Query  83   *  83
            *
Sbjct  308  *  310


>XM_006359423.1 PREDICTED: Solanum tuberosum defensin-like protein (LOC102604117), 
mRNA
Length=344

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +3

Query  23   TEMGTMKT-AEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRT  81
            TEMG M   AEARTC SQSH FKG C+ ++NCA+VC+TE F  G+C    + R+C+C R 
Sbjct  75   TEMGPMSGGAEARTCESQSHSFKGPCVGDTNCASVCQTEGFIGGDCRG--LRRQCFCTRN  248

Query  82   C*  83
            C*
Sbjct  249  C*  254


>FQ392292.1 Vitis vinifera clone SS0AFA6YG07
Length=509

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>BT070807.1 Picea sitchensis clone WS02750_O01 unknown mRNA
Length=591

 Score = 70.1 bits (170),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEARTC + S KFKG C S++NC  VC+TE FP G C+ H+  RKCYC + C
Sbjct  130  MIQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  303


>FQ388050.1 Vitis vinifera clone SS0AEB24YG21
Length=520

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ386514.1 Vitis vinifera clone SS0AEB29YK11
Length=513

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ385666.1 Vitis vinifera clone SS0AEB31YI09
Length=514

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>HM240259.1 Phaseolus vulgaris cultivar BAT93 defensin D2 mRNA, complete 
cds
Length=596

 Score = 70.1 bits (170),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG    AEARTC SQSH+FKG C+S++NCA+VCRTE F  G C      R+C+C + C
Sbjct  296  TEMGPRMVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRG--FRRRCFCTKHC  469

Query  83   *  83
            *
Sbjct  470  *  472


>XM_016640369.1 PREDICTED: Nicotiana tabacum defensin J1-2-like (LOC107814872), 
mRNA
Length=478

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGTM  AEARTC SQSH+FKG C+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  67   TEMGTM-VAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRG--FRRRCFCTKHC  237

Query  83   *  83
            *
Sbjct  238  *  240


>FQ393327.1 Vitis vinifera clone SS0AFA26YJ07
Length=516

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ385920.1 Vitis vinifera clone SS0AEB30YK02
Length=517

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ389825.1 Vitis vinifera clone SS0AEB19YJ01
Length=517

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ386860.1 Vitis vinifera clone SS0AEB28YI04
 FQ386873.1 Vitis vinifera clone SS0AEB28YH13
 FQ387164.1 Vitis vinifera clone SS0AEB27YH20
Length=520

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ378957.1 Vitis vinifera clone SS0AEB11YO08
Length=520

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ388235.1 Vitis vinifera clone SS0AEB23YM16
Length=522

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ389552.1 Vitis vinifera clone SS0AEB1YH03
Length=524

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>XM_009606271.1 PREDICTED: Nicotiana tomentosiformis defensin J1-2-like (LOC104099318), 
mRNA
Length=476

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGTM  AEARTC SQSH+FKG C+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  116  TEMGTM-VAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRG--FRRRCFCTKHC  286

Query  83   *  83
            *
Sbjct  287  *  289


>FQ389592.1 Vitis vinifera clone SS0AEB1YE24
Length=528

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>XM_009611916.1 PREDICTED: Nicotiana tomentosiformis defensin J1-2 (LOC104103943), 
mRNA
Length=480

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C S SNCA+VC TE F  G C      R+C+C R C
Sbjct  130  TEMGPM-VAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRG--FRRRCFCTRHC  300

Query  83   *  83
            *
Sbjct  301  *  303


>FQ390520.1 Vitis vinifera clone SS0AEB17YH17
Length=514

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ391273.1 Vitis vinifera clone SS0AEB15YD04
 FQ387746.1 Vitis vinifera clone SS0AEB25YH14
Length=532

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ390795.1 Vitis vinifera clone SS0AEB16YK10
Length=533

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ385139.1 Vitis vinifera clone SS0AEB3YE02
Length=532

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>JQ654635.1 Nicotiana tabacum defensin (DEF2) mRNA, complete cds
Length=480

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C S SNCA+VC TE F  G C      R+C+C R C
Sbjct  120  TEMGPM-VAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRG--FRRRCFCTRHC  290

Query  83   *  83
            *
Sbjct  291  *  293


>FQ387008.1 Vitis vinifera clone SS0AEB28YA08
Length=520

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>EF677104.1 Picea sitchensis clone WS02761_N13 unknown mRNA
Length=579

 Score = 69.7 bits (169),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEAR C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  143  MMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  316


>XM_004985795.1 PREDICTED: Setaria italica defensin SD2-like (LOC101784585), 
mRNA
Length=712

 Score = 70.5 bits (171),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +3

Query  26   GTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            G +  AEARTCLSQSHKF+G C+  +NCA VCRTE FPDG+C    + R+C+C   C
Sbjct  210  GPVGVAEARTCLSQSHKFRGPCVRRANCANVCRTEGFPDGKCRG--LRRRCFCTTHC  374


>XM_003628931.1 Medicago truncatula Defensin MtDef4.4 partial mRNA
Length=237

 Score = 67.0 bits (162),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG +  AEARTC + S+ FKG C+S++NCA+VC+TE FP G C      ++C+C + C
Sbjct  61   TEMGPIMVAEARTCETPSNNFKGLCVSDTNCASVCQTEGFPGGHCEGF--RQRCFCTKPC  234

Query  83   *  83
            *
Sbjct  235  *  237


>AY108837.1 Zea mays PCO070355 mRNA sequence
Length=557

 Score = 69.7 bits (169),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  30   TAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
              E   CLSQSH FKG CLSN+NC  VC+TE F  GEC    V RKCYCK+ C*
Sbjct  147  VVEETLCLSQSHAFKGVCLSNTNCDNVCKTEKFTGGECKMDGVMRKCYCKKVC*  308


>XM_016638641.1 PREDICTED: Nicotiana tabacum defensin J1-2 (LOC107813378), mRNA
Length=526

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C S SNCA+VC TE F  G C      R+C+C R C
Sbjct  139  TEMGPM-VAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRG--FRRRCFCTRHC  309

Query  83   *  83
            *
Sbjct  310  *  312


>X91487.1 P.abies mRNA for gamma-thionin protein (putative)
Length=490

 Score = 68.9 bits (167),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AE RTC + S KFKG C S++NC  VC+TE FP G C+ H+  RKCYC + C
Sbjct  96   MMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  269


>XM_016659151.1 PREDICTED: Nicotiana tabacum defensin J1-2-like (LOC107831389), 
transcript variant X2, mRNA
Length=504

 Score = 68.9 bits (167),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGTM  AEARTC SQSH+FKG C+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  116  TEMGTM-VAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRG--FRRRCFCTKHC  286

Query  83   *  83
            *
Sbjct  287  *  289


>XM_016659150.1 PREDICTED: Nicotiana tabacum defensin J1-2-like (LOC107831389), 
transcript variant X1, mRNA
Length=504

 Score = 68.9 bits (167),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGTM  AEARTC SQSH+FKG C+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  116  TEMGTM-VAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRG--FRRRCFCTKHC  286

Query  83   *  83
            *
Sbjct  287  *  289


>FQ386967.1 Vitis vinifera clone SS0AEB28YC19
Length=559

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ395665.1 Vitis vinifera clone SS0AFA14YL10
 FQ379389.1 Vitis vinifera clone SS0AEB10YJ10
Length=558

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FJ132500.1 Pinus taeda isolate 6798 anonymous locus CL2287Contig1_03 genomic 
sequence
Length=200

 Score = 66.6 bits (161),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  28   MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            ++ AE RTC + S KFKG C++++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  3    VQEAEGRTCKTPSGKFKGYCVNSTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPC  167


>FJ132488.1 Pinus taeda isolate 6802 anonymous locus CL2287Contig1_03 genomic 
sequence
 FJ132489.1 Pinus taeda isolate 6789 anonymous locus CL2287Contig1_03 genomic 
sequence
 FJ132490.1 Pinus taeda isolate 6793 anonymous locus CL2287Contig1_03 genomic 
sequence
 15 more sequence titles
 Length=200

 Score = 66.6 bits (161),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  28   MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            ++ AE RTC + S KFKG C++++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  3    VQEAEGRTCKTPSGKFKGYCVNSTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPC  167


>DQ224256.1 Aquilegia formosa putative defensin (DEF1) mRNA, partial cds
Length=329

 Score = 67.8 bits (164),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG +K AEAR C SQSHKFKGTC+  SNCA+VC++E F  G C    V R+CYC   C
Sbjct  36   TEMG-LKVAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRG--VTRRCYCTAKC  206


>XM_010910678.1 PREDICTED: Elaeis guineensis defensin Ec-AMP-D1-like (LOC105035217), 
mRNA
Length=645

 Score = 70.1 bits (170),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            +EMGT K AEARTC SQSHKF+GTCL  SNCA VC+TE F  G C    V R+C+C R C
Sbjct  220  SEMGT-KVAEARTCESQSHKFQGTCLRESNCANVCQTEGFQGGVCRG--VRRRCFCTRLC  390

Query  83   *  83
            *
Sbjct  391  *  393


>FQ388011.1 Vitis vinifera clone SS0AEB24YI18
Length=569

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>EF083778.1 Picea sitchensis clone WS02722_N20 unknown mRNA
Length=613

 Score = 69.7 bits (169),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEAR C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  144  MMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  317


>FQ386663.1 Vitis vinifera clone SS0AEB29YC19
Length=530

 Score = 69.3 bits (168),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGS--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>EF081628.1 Picea sitchensis clone WS02814_K22 unknown mRNA
Length=637

 Score = 69.7 bits (169),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEAR C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  142  MMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  315


>BT115656.1 Picea glauca clone GQ03703_N18 mRNA sequence
Length=604

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEARTC + S KFKG C S++NC  VC+TE FP G C+ H+  RKCYC + C
Sbjct  129  MMQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  302


>XM_009616193.1 PREDICTED: Nicotiana tomentosiformis defensin J1-2-like (LOC104107399), 
mRNA
Length=534

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGTM  AEARTC SQSH+FKG C+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  120  TEMGTM-VAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRG--FRRRCFCTKHC  290

Query  83   *  83
            *
Sbjct  291  *  293


>XM_002274317.2 PREDICTED: Vitis vinifera defensin Ec-AMP-D2 (LOC100242603), 
mRNA
Length=581

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  147  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  317

Query  83   *  83
            *
Sbjct  318  *  320


>NM_001156902.1 Zea mays low-molecular-weight cysteine-rich protein LCR69 (LOC100284004), 
mRNA
 EU966725.1 Zea mays clone 296765 low-molecular-weight cysteine-rich protein 
LCR69 precursor, mRNA, complete cds
Length=640

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  30   TAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
              E   CLSQSH FKG CLSN+NC  VC+TE F  GEC    V RKCYCK+ C*
Sbjct  163  VVEETLCLSQSHAFKGVCLSNTNCDNVCKTEKFTGGECKMDGVMRKCYCKKVC*  324


>BT115846.1 Picea glauca clone GQ03707_G02 mRNA sequence
Length=616

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AEAR C + S KFKG C+S++NC  VCRTE FP G C+ H+  RKCYC + C
Sbjct  137  MMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPC  310


>XM_015773314.1 PREDICTED: Oryza sativa Japonica Group defensin-like protein 
(LOC4331501), mRNA
Length=468

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  26   GTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            G +  AEARTC SQSH+FKG C   +NCA+VC TE FPDG C  H V R+C C + C
Sbjct  164  GPVMVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYC--HGVRRRCMCTKPC  328


>XM_009793922.1 PREDICTED: Nicotiana sylvestris defensin-like protein P322 (LOC104239312), 
mRNA
Length=430

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQ H+FKG C  + NCA VC TE F  G+C    + R+C+C R C
Sbjct  122  TEMGPMTIAEARTCESQRHRFKGPCSRDGNCATVCLTEGFSGGDCRG--LRRRCFCTRPC  295

Query  83   *  83
            *
Sbjct  296  *  298


>BT131396.1 Oryza sativa clone RRlibD00348 mRNA sequence
Length=499

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = -2

Query  26   GTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            G +  AEARTC SQSH+FKG C   +NCA+VC TE FPDG C  H V R+C C + C
Sbjct  381  GPVMVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYC--HGVRRRCMCTKPC  217


>XM_016620513.1 PREDICTED: Nicotiana tabacum defensin J1-2-like (LOC107797614), 
mRNA
Length=493

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGTM  A+ARTC SQSH+FKG C+  SNCAAVC+TE F  G C    + R+C+C + C
Sbjct  111  TEMGTM-VADARTCESQSHRFKGPCVRKSNCAAVCQTEGFHAGHCRG--IRRRCFCTKHC  281

Query  83   *  83
            *
Sbjct  282  *  284


>KX139061.1 Nicotiana benthamiana defensin-like protein 2 mRNA, complete 
cds
Length=237

 Score = 65.9 bits (159),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEAR C S+S +FKG C+   NCAAVC TE F  G+C    + R+C+C R C
Sbjct  61   TEMGPMTVAEARRCESKSQRFKGPCVRVKNCAAVCETEGFSGGDCRG--LRRRCFCTRPC  234

Query  83   *  83
            *
Sbjct  235  *  237


>XM_009801834.1 PREDICTED: Nicotiana sylvestris defensin J1-2-like (LOC104246093), 
mRNA
Length=506

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMGTM  A+ARTC SQSH+FKG C+  SNCAAVC+TE F  G C    + R+C+C + C
Sbjct  124  TEMGTM-VADARTCESQSHRFKGPCVRKSNCAAVCQTEGFHAGHCRG--IRRRCFCTKHC  294

Query  83   *  83
            *
Sbjct  295  *  297


>NM_001159479.1 Zea mays uncharacterized LOC100285747 (pco070355), mRNA
 EU973700.1 Zea mays clone 406900 low-molecular-weight cysteine-rich protein 
LCR69 precursor, mRNA, complete cds
Length=631

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  30   TAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
              E   CLSQSH FKG CLSN+NC  VC+TE F  GEC    V RKCYCK+ C*
Sbjct  155  VVEETLCLSQSHAFKGVCLSNTNCDNVCKTEKFTGGECKMDGVMRKCYCKKVC*  316


>AY307056.1 Hyacinthus orientalis cultivar Delft Blue proteinase inhibitor-like 
mRNA, partial sequence
Length=420

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +2

Query  23   TEMGTMKTA-EARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRT  81
            TEMG      E+RTCLS SH+FKG C+  SNCA+VC++E FPDG+C    + R+C+C + 
Sbjct  104  TEMGAGGGGVESRTCLSASHRFKGPCVRVSNCASVCQSEGFPDGQCVG--LRRRCFCSKP  277

Query  82   C*  83
            C*
Sbjct  278  C*  283


>EF145840.1 Populus trichocarpa clone WS0113_L16 unknown mRNA
Length=447

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +3

Query  28   MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            M  AEAR CLSQSH FKG C+   NCA+VC+TE FP GEC      R+C+C + C*
Sbjct  138  MVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKG--FRRRCFCAKPC*  299


>EF144814.1 Populus trichocarpa clone WS01118_J09 unknown mRNA
Length=452

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +1

Query  28   MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            M  AEAR CLSQSH FKG C+   NCA+VC+TE FP GEC      R+C+C + C*
Sbjct  139  MVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKG--FRRRCFCAKPC*  300


>EF145374.1 Populus trichocarpa clone WS01123_N11 unknown mRNA
Length=454

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +3

Query  28   MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            M  AEAR CLSQSH FKG C+   NCA+VC+TE FP GEC      R+C+C + C*
Sbjct  147  MVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKG--FRRRCFCAKPC*  308


>EF144827.1 Populus trichocarpa clone WS01118_L07 unknown mRNA
 EF146346.1 Populus trichocarpa clone WS0117_F20 unknown mRNA
Length=456

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +2

Query  28   MKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            M  AEAR CLSQSH FKG C+   NCA+VC+TE FP GEC      R+C+C + C*
Sbjct  143  MVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKG--FRRRCFCAKPC*  304


>AK120826.1 Oryza sativa Japonica Group cDNA clone:J023019E10, full insert 
sequence
Length=540

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  26   GTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            G +  AEARTC SQSH+FKG C   +NCA+VC TE FPDG C  H V R+C C + C
Sbjct  119  GPVMVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYC--HGVRRRCMCTKPC  283


>EF081568.1 Picea sitchensis clone WS0285_L10 unknown mRNA
Length=535

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AE RTC + S KFKG C S++NC  VC+TE FP G C+ H+  RKCYC + C
Sbjct  130  MMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  303


>FQ390153.1 Vitis vinifera clone SS0AEB18YJ05
Length=518

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ386817.1 Vitis vinifera clone SS0AEB28YK09
Length=529

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKGTC+  SNC AVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARTCESQSHRFKGTCVRQSNCVAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ379531.1 Vitis vinifera clone SS0AEB10YC18
Length=518

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ389253.1 Vitis vinifera clone SS0AEB20YG12
Length=517

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ390247.1 Vitis vinifera clone SS0AEB18YE19
Length=516

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>KP017278.1 Nicotiana benthamiana defensin-like protein 1.2 (PDF1.2) mRNA, 
complete cds
Length=237

 Score = 65.9 bits (159),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +1

Query  24   EMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC*  83
            EMG    AEARTC SQSH+FKG C  +SNCA VC TE F  G+C      R+C+C R C*
Sbjct  64   EMGPTTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRG--FRRRCFCTRPC*  237


>FQ397945.1 Vitis vinifera clone SS0AEB5YD07
Length=517

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ379599.1 Vitis vinifera clone SS0AEA1YP12
Length=513

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +1

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  103  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  273

Query  83   *  83
            *
Sbjct  274  *  276


>FQ378998.1 Vitis vinifera clone SS0AEB11YM09
Length=514

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ390306.1 Vitis vinifera clone SS0AEB18YC03
Length=519

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEAR C SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TEMGPM-VAEARACESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRG--FRRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>EU849681.1 Solanum tuberosum protease inhibitor-related protein (PI) mRNA, 
complete cds
Length=509

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +2

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M+ AEAR C S SH+FKG C  +SNCA+VC TE F  G C  H   R+C+C + C
Sbjct  101  TEMGPMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNC--HGFRRRCFCTKPC  274

Query  83   *  83
            *
Sbjct  275  *  277


>FQ385637.1 Vitis vinifera clone SS0AEB31YJ18
Length=517

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ387078.1 Vitis vinifera clone SS0AEB27YM06
Length=510

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>EF085766.1 Picea sitchensis clone WS02752_G19 unknown mRNA
Length=616

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +2

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AE RTC + S KFKG C S++NC  VC+TE FP G C+ H+  RKCYC + C
Sbjct  131  MMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  304


>EF086006.1 Picea sitchensis clone WS02922_O20 unknown mRNA
Length=592

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  25   MGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            M  ++ AE RTC + S KFKG C S++NC  VC+TE FP G C+ H+  RKCYC + C
Sbjct  118  MMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  291


>FQ389397.1 Vitis vinifera clone SS0AEB1YP12
Length=518

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ391109.1 Vitis vinifera clone SS0AEB15YK13
Length=529

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>FQ378674.1 Vitis vinifera clone SS0AEB12YN15
Length=528

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            T+MG M T EARTC SQSH+FKGTC+  SNCAAVC+TE F  G C      R+C+C + C
Sbjct  108  TDMGPMVT-EARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGF--RRRCFCTKHC  278

Query  83   *  83
            *
Sbjct  279  *  281


>XM_006585813.2 PREDICTED: Glycine max defensin-like protein (LOC100798577), 
mRNA
Length=628

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKR  80
            TEMG    AEARTC SQSH+FKG CLS++NC +VCRTE F  G C      R+C+C +
Sbjct  156  TEMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRG--FSRRCFCTK  323


>X99403.1 N.tabacum mRNA for defensin
Length=486

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +3

Query  23   TEMGTMKTAEARTCLSQSHKFKGTCLSNSNCAAVCRTENFPDGECNTHLVERKCYCKRTC  82
            TEMG M  AEARTC SQSH+FKG C  +SNCA VC TE F  G C    +  +C+C   C
Sbjct  99   TEMGPMTIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGRCP--WIPPRCFCTSPC  272

Query  83   *  83
            *
Sbjct  273  *  275



Lambda      K        H
   0.330    0.131    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1054173400592


  Database: Nucleotide collection (nt)
    Posted date:  Oct 4, 2016  2:28 PM
  Number of letters in database: 128,339,311,604
  Number of sequences in database:  39,204,206



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40