TBLASTN 2.5.0+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.



Database: Nucleotide collection (nt)
           39,204,206 sequences; 128,339,311,604 total letters



Query= 
Length=74
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

XM_013609259.1  Medicago truncatula Defensin MtDef2.1 mRNA            152     9e-46
EU920048.1  Vicia faba clone 042 D02 defensin-like protein mRNA, ...  136     1e-40
EU920047.1  Vicia faba clone 039 F05 defensin-like protein mRNA, ...  135     2e-40
EU920044.1  Vicia faba clone 004 C04 defensin-like protein mRNA, ...  135     2e-40
FJ174689.1  Pisum sativum pathogenesis-related protein mRNA, comp...  132     9e-38
DQ288897.2  Cicer arietinum defensin (AFP-Ca) mRNA, complete cds      120     3e-34
XM_004487638.2  PREDICTED: Cicer arietinum defensin-like protein ...  121     1e-33
AY907349.1  Tephrosia villosa defensin mRNA, complete cds             116     9e-33
BT090977.1  Soybean clone JCVI-FLGm-5F24 unknown mRNA                 119     1e-32
XM_003543198.3  PREDICTED: Glycine max defensin-like protein (LOC...  119     3e-32
X16877.1  Vigna unguiculata cDNA for stored cotyledon mRNA            116     1e-31
AB020613.1  Vigna radiata mRNA for PDF1, complete cds                 116     2e-31
XM_014636686.1  PREDICTED: Vigna radiata var. radiata defensin-li...  116     2e-31
HM240258.1  Phaseolus vulgaris cultivar BAT93 defensin D1 mRNA, c...  115     4e-31
LN913082.1  Vigna radiata mRNA for defensin protein (PDF1 gene), ...  112     5e-31
LN901492.1  Vigna radiata PDF1 gene for defensin protein, cultiva...  112     5e-31
XM_017568810.1  PREDICTED: Vigna angularis defensin-like protein ...  114     9e-31
XM_007149386.1  Phaseolus vulgaris hypothetical protein (PHAVU_00...  114     2e-30
AY313169.1  Medicago truncatula defensin (Def2.1) gene, complete cds  116     3e-30
JQ314214.1  Psophocarpus tetragonolobus defensin mRNA, complete cds   109     7e-30
XM_007149387.1  Phaseolus vulgaris hypothetical protein (PHAVU_00...  109     1e-28
LN913083.1  Vigna radiata mRNA for defensin protein (PDF1 gene), ...  106     1e-28
LN901493.1  Vigna radiata PDF1 gene for defensin protein, cultiva...  106     1e-28
EU920046.1  Vicia faba clone 016 E08 defensin-like protein mRNA, ...  105     2e-28
EU920045.1  Vicia faba clone 011 F07 defensin-like protein mRNA, ...  105     2e-28
XM_016081189.1  PREDICTED: Arachis duranensis defensin-1-like (LO...  108     2e-28
JQ314215.1  Clitoria ternatea defensin mRNA, complete cds             105     4e-28
XR_001614224.1  PREDICTED: Arachis ipaensis uncharacterized LOC10...  108     6e-28
AY681973.1  Medicago sativa putative defensin 2.1 precursor (Def2...  107     8e-28
JX424594.1  Arachis hypogaea low molecular weight cysteine-rich p...  102     3e-27
AY182164.1  Arachis diogoi antifungal protein defensin mRNA, comp...  102     3e-27
AY227192.1  Trigonella foenum-graecum defensin mRNA, complete cds     102     3e-27
DQ296045.1  Arachis hypogaea disease resistance response protein ...  102     4e-27
EF194158.1  Lens culinaris subsp. culinaris defensin precursor, m...  104     5e-27
L01579.1  Pisum sativum disease resistance response protein 39 (D...  104     5e-27
KF498667.1  Synthetic construct defensin 2/antifungal protein 2 f...  103     1e-26
AY681971.1  Medicago sativa putative defensin 1.2 precursor (Def1...  100     2e-26
AY288448.1  Arachis diogoi defensin mRNA, complete cds                100     3e-26
AF319468.1  Medicago sativa antifungal protein precursor, mRNA, c...  102     3e-26
XM_016081261.1  PREDICTED: Arachis duranensis defensin-like prote...  102     5e-26
XM_013609260.1  Medicago truncatula Defensin MtDef1.1/MtDef1.2 mRNA   101     5e-26
XM_016316566.1  PREDICTED: Arachis ipaensis defensin-like protein...  102     6e-26
AF525685.1  Pisum sativum antimicrobial defensin peptide DRR230-c...  95.1    2e-24
AP015040.1  Vigna angularis var. angularis DNA, chromosome 7, alm...  96.7    1e-21
DQ342338.1  Cicer arietinum defensin (AFP) gene, promoter region ...  89.4    1e-20
AF139018.1  Pisum sativum disease resistance response protein 230...  85.5    6e-20
AY560900.1  Medicago sativa putative defensin 3.2 (Def3.2) gene, ...  89.7    9e-20
AY560901.1  Medicago truncatula putative defensin 3.1 (Def3.1) ge...  84.7    9e-20
JX424606.1  Arachis hypogaea low molecular weight cysteine-rich p...  86.3    4e-19
KJ939334.1  Phaseolus vulgaris cultivar polesta defensin (pdf) ge...  84.3    5e-19
AY313166.1  Medicago truncatula defensin (Def1) gene, complete cds    82.8    6e-19
LN901494.1  Vigna radiata PDF1 gene intron, cultivar Dautam           81.6    2e-18
AY679170.1  Pachyrhizus erosus defensin (spe10) mRNA, partial cds     76.3    5e-17
FJ380052.1  Vigna unguiculata defensin mRNA, partial cds              75.5    1e-16
AY560899.1  Medicago sativa putative defensin 3.1 (Def3.1) gene, ...  78.2    2e-16
LN901495.1  Vigna radiata PDF1 gene intron, cultivar DX22             73.6    3e-15
AY571902.1  Medicago truncatula cultivar Jemalong Def3.1 (Def3.1)...  77.8    5e-15
XR_001614223.1  PREDICTED: Arachis ipaensis uncharacterized LOC10...  74.3    9e-15
AF535089.1  Trigonella foenum-graecum defensin gene, complete cds     72.0    1e-13
AY681970.1  Medicago sativa putative defensin 1.3 precursor (Def1...  71.6    2e-13
AY681967.1  Medicago sativa putative defensin 1.6 precursor (Def1...  71.6    2e-13
AY681969.1  Medicago sativa putative defensin 1.4 precursor (Def1...  71.6    2e-13
L01578.1  Pea (pi230) disease resistance response protein 230 (DR...  69.7    3e-13
AY681968.1  Medicago sativa putative defensin 1.5 precursor (Def1...  69.7    9e-13
KF672189.1  Sophora chathamica microsatellite Sop-807 sequence        68.9    4e-12
XM_013597344.1  Medicago truncatula Nodule Cysteine-Rich (NCR) se...  60.5    2e-10
XM_006423263.1  Citrus clementina hypothetical protein (CICLE_v10...  61.2    7e-10
FJ948813.2  Nicotiana megalosiphon putative defensin mRNA, comple...  56.2    7e-09
XM_010676850.1  PREDICTED: Beta vulgaris subsp. vulgaris defensin...  57.0    4e-08
XM_003630374.2  Medicago truncatula Defensin MtDef4.7 mRNA            55.5    6e-08
XM_012216514.1  PREDICTED: Jatropha curcas defensin-like protein ...  54.7    6e-08
XM_010066325.1  PREDICTED: Eucalyptus grandis defensin-like prote...  52.4    5e-07
XM_006495244.2  PREDICTED: Citrus sinensis defensin-like protein ...  53.5    8e-07
XM_006423264.1  Citrus clementina hypothetical protein (CICLE_v10...  51.2    9e-07
XM_009760689.1  PREDICTED: Nicotiana sylvestris defensin-like pro...  51.6    9e-07
XM_015199257.1  PREDICTED: Solanum pennellii defensin-like protei...  50.4    2e-06
XM_010676851.1  PREDICTED: Beta vulgaris subsp. vulgaris defensin...  52.8    2e-06
XR_001658616.1  PREDICTED: Nicotiana tabacum uncharacterized LOC1...  52.0    2e-06
XR_685286.1  PREDICTED: Nicotiana tomentosiformis uncharacterized...  52.0    2e-06
XM_012987705.1  PREDICTED: Erythranthe guttatus defensin-like pro...  50.1    2e-06
XM_010322203.1  PREDICTED: Solanum lycopersicum defensin-like pro...  50.8    3e-06
XM_006423265.1  Citrus clementina hypothetical protein (CICLE_v10...  51.2    4e-06
XR_001643946.1  PREDICTED: Nicotiana tabacum uncharacterized LOC1...  51.2    4e-06
XM_013588571.1  Medicago truncatula Defensin-like protein mRNA        51.2    6e-06
XM_015226355.1  PREDICTED: Solanum pennellii defensin-like protei...  50.4    7e-06
DQ446381.1  Arabidopsis thaliana clone pENTR221-At1g61070 plant d...  48.9    7e-06
XM_004242803.2  PREDICTED: Solanum lycopersicum defensin-like pro...  50.4    7e-06
EF145035.1  Populus trichocarpa clone WS0111_K17 unknown mRNA         50.8    8e-06
XR_742235.1  PREDICTED: Solanum lycopersicum uncharacterized LOC1...  50.4    9e-06
XM_010321070.1  PREDICTED: Solanum lycopersicum defensin Ec-AMP-D...  49.3    9e-06
DQ652906.1  Arabidopsis thaliana clone 0000019027_0000013118 unkn...  48.5    9e-06
XM_015305081.1  PREDICTED: Solanum tuberosum defensin-like protei...  47.8    1e-05
XM_015226472.1  PREDICTED: Solanum pennellii defensin-like protei...  48.5    1e-05


>XM_013609259.1 Medicago truncatula Defensin MtDef2.1 mRNA
Length=463

 Score = 152 bits (383),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG
Sbjct  59   MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  238

Query  61   TCHNFQCFCTQNC*  74
            TCHNFQCFCTQNC*
Sbjct  239  TCHNFQCFCTQNC*  280


>EU920048.1 Vicia faba clone 042 D02 defensin-like protein mRNA, complete 
cds
Length=222

 Score = 136 bits (343),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKKS+A L  LFLVLFVAQEI VTEARTCEHLADTYRGPC T  SCDDHCKNKAHLISG
Sbjct  1    MEKKSVAALSFLFLVLFVAQEIVVTEARTCEHLADTYRGPCLTNASCDDHCKNKAHLISG  180

Query  61   TCHNFQCFCTQNC*  74
            TCHN++CFCTQNC*
Sbjct  181  TCHNYKCFCTQNC*  222


>EU920047.1 Vicia faba clone 039 F05 defensin-like protein mRNA, complete 
cds
Length=222

 Score = 135 bits (341),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKK++A L  LFLVLFVAQEI VTEARTCEHLADTYRGPC T+ SCDDHCKNKAHLISG
Sbjct  1    MEKKAVAALSFLFLVLFVAQEIVVTEARTCEHLADTYRGPCLTDASCDDHCKNKAHLISG  180

Query  61   TCHNFQCFCTQNC*  74
            TCHN++CFCTQNC*
Sbjct  181  TCHNYKCFCTQNC*  222


>EU920044.1 Vicia faba clone 004 C04 defensin-like protein mRNA, complete 
cds
Length=222

 Score = 135 bits (341),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKK++A L  LFLVLFVAQEI VTEARTCEHLADTYRGPC T+ SCDDHCKNKAHLISG
Sbjct  1    MEKKAVAALSFLFLVLFVAQEIVVTEARTCEHLADTYRGPCLTDASCDDHCKNKAHLISG  180

Query  61   TCHNFQCFCTQNC*  74
            TCHN++CFCTQNC*
Sbjct  181  TCHNYKCFCTQNC*  222


>FJ174689.1 Pisum sativum pathogenesis-related protein mRNA, complete cds
Length=515

 Score = 132 bits (332),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKK++A L  LFLVLFVAQEI VTEA+TCEHLADTYRG CFT  SCDDHCKNKAHLISG
Sbjct  63   MEKKAVAALSFLFLVLFVAQEIVVTEAKTCEHLADTYRGVCFTNASCDDHCKNKAHLISG  242

Query  61   TCHNFQCFCTQNC*  74
            TCHN++CFCTQNC*
Sbjct  243  TCHNWKCFCTQNC*  284


>DQ288897.2 Cicer arietinum defensin (AFP-Ca) mRNA, complete cds
Length=225

 Score = 120 bits (300),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            M+KKS+AGLC LFLVLFVA+EIAV+EA  CE+LADTYRGPCFT GSCDDHCKNK HL+SG
Sbjct  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  180

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+NC*
Sbjct  181  RCRDDFRCWCTKNC*  225


>XM_004487638.2 PREDICTED: Cicer arietinum defensin-like protein (LOC101512021), 
mRNA
Length=465

 Score = 121 bits (304),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            M+KKS+AGLC LFLVLFVAQEIAV+EA  CE+LADTYRGPCFT GSCDDHCKNK HL+SG
Sbjct  77   MDKKSLAGLCFLFLVLFVAQEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  256

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+NC*
Sbjct  257  RCRDDFRCWCTRNC*  301


>AY907349.1 Tephrosia villosa defensin mRNA, complete cds
Length=228

 Score = 116 bits (291),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS+AGLC LFLVLFVAQE+ V +EA+TCE+LADTYRGPCFT GSCDDHCKNK HL+S
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEVVVQSEAKTCENLADTYRGPCFTTGSCDDHCKNKEHLLS  180

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+ C*
Sbjct  181  GRCRDDFRCWCTKRC*  228


>BT090977.1 Soybean clone JCVI-FLGm-5F24 unknown mRNA
Length=513

 Score = 119 bits (298),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = +3

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKSIAGLC LFLVLFVAQE+ V TEA+TCE+LADTYRGPCFT GSCDDHCKNK HL+ 
Sbjct  69   MEKKSIAGLCFLFLVLFVAQEVVVQTEAKTCENLADTYRGPCFTTGSCDDHCKNKEHLLR  248

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  249  GRCRDDFRCWCTKNC*  296


>XM_003543198.3 PREDICTED: Glycine max defensin-like protein (LOC100779239), 
mRNA
Length=578

 Score = 119 bits (298),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKSIAGLC LFLVLFVAQE+ V TEA+TCE+LADTYRGPCFT GSCDDHCKNK HL+ 
Sbjct  83   MEKKSIAGLCFLFLVLFVAQEVVVQTEAKTCENLADTYRGPCFTTGSCDDHCKNKEHLLR  262

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  263  GRCRDDFRCWCTKNC*  310


>X16877.1 Vigna unguiculata cDNA for stored cotyledon mRNA
Length=459

 Score = 116 bits (290),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKSIAGLC LFLVLFVAQE+ V +EA+TCE+L DTYRGPCFT GSCDDHCKNK HL+S
Sbjct  14   MEKKSIAGLCFLFLVLFVAQEVVVQSEAKTCENLVDTYRGPCFTTGSCDDHCKNKEHLLS  193

Query  60   GTCH-NFQCFCTQNC*  74
            G C  + +C+CT+NC*
Sbjct  194  GRCRDDVRCWCTRNC*  241


>AB020613.1 Vigna radiata mRNA for PDF1, complete cds
Length=496

 Score = 116 bits (290),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS+AGLC LFLVLFVAQE+ V TEA+TCE+LA+TYRGPCFT GSCDDHCKNK HL S
Sbjct  46   MEKKSLAGLCFLFLVLFVAQEVMVQTEAKTCENLANTYRGPCFTTGSCDDHCKNKEHLRS  225

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  226  GRCRDDFRCWCTRNC*  273


>XM_014636686.1 PREDICTED: Vigna radiata var. radiata defensin-like protein (LOC106754639), 
mRNA
Length=510

 Score = 116 bits (290),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS+AGLC LFLVLFVAQE+ V TEA+TCE+LA+TYRGPCFT GSCDDHCKNK HL S
Sbjct  59   MEKKSLAGLCFLFLVLFVAQEVMVQTEAKTCENLANTYRGPCFTTGSCDDHCKNKEHLRS  238

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  239  GRCRDDFRCWCTRNC*  286


>HM240258.1 Phaseolus vulgaris cultivar BAT93 defensin D1 mRNA, complete 
cds
Length=537

 Score = 115 bits (289),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS+AGLC LFLVLFVAQE+ + TEA+TCE+LADTY+GPCFT GSCDDHCKNK HL S
Sbjct  50   MEKKSLAGLCFLFLVLFVAQEVVLQTEAKTCENLADTYKGPCFTTGSCDDHCKNKEHLRS  229

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  230  GRCRDDFRCWCTKNC*  277


>LN913082.1 Vigna radiata mRNA for defensin protein (PDF1 gene), cultivar 
Dautam
Length=228

 Score = 112 bits (280),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS  GLC LFLVLFVAQE+ V TEA+TCE+LA+TYRGPCF  GSCDDHCKNK HL S
Sbjct  1    MEKKSWPGLCFLFLVLFVAQEVMVQTEAKTCENLANTYRGPCFPTGSCDDHCKNKEHLRS  180

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  181  GRCRDDFRCWCTRNC*  228


>LN901492.1 Vigna radiata PDF1 gene for defensin protein, cultivar Dautam
Length=228

 Score = 112 bits (280),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS  GLC LFLVLFVAQE+ V TEA+TCE+LA+TYRGPCF  GSCDDHCKNK HL S
Sbjct  1    MEKKSWPGLCFLFLVLFVAQEVMVQTEAKTCENLANTYRGPCFPTGSCDDHCKNKEHLRS  180

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  181  GRCRDDFRCWCTRNC*  228


>XM_017568810.1 PREDICTED: Vigna angularis defensin-like protein (LOC108333379), 
mRNA
Length=527

 Score = 114 bits (286),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS+AGLC LFLVLFVAQE+ V TEARTCE+LA++YRGPC T GSCDDHCKNK HL S
Sbjct  73   MEKKSLAGLCFLFLVLFVAQEVVVQTEARTCENLANSYRGPCITTGSCDDHCKNKEHLNS  252

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  253  GRCRDDFRCWCTKNC*  300


>XM_007149386.1 Phaseolus vulgaris hypothetical protein (PHAVU_005G071300g) mRNA, 
complete cds
Length=560

 Score = 114 bits (284),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS+AGLC LFLVLFV QE+ + TEA+TCE+LADTY+GPCFT GSCDDHCKNK HL S
Sbjct  73   MEKKSLAGLCFLFLVLFVTQEVVLQTEAKTCENLADTYKGPCFTTGSCDDHCKNKEHLRS  252

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  253  GRCRDDFRCWCTKNC*  300


>AY313169.1 Medicago truncatula defensin (Def2.1) gene, complete cds
Length=876

 Score = 116 bits (291),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  13   FLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCHNFQCFCTQN  72
            +     A+EIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCHNFQCFCTQN
Sbjct  691  YWWYLDAEEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCHNFQCFCTQN  870

Query  73   C*  74
            C*
Sbjct  871  C*  876


>JQ314214.1 Psophocarpus tetragonolobus defensin mRNA, complete cds
Length=228

 Score = 109 bits (272),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            M+KKS+AGLC LFLVLFVAQE+ V TEA+TCE+LADT+RGPCF   +CDDHCKNK HL+ 
Sbjct  1    MDKKSLAGLCFLFLVLFVAQEVVVQTEAKTCENLADTFRGPCFATANCDDHCKNKEHLLR  180

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +++C+CT+NC*
Sbjct  181  GRCRDDYRCWCTKNC*  228


>XM_007149387.1 Phaseolus vulgaris hypothetical protein (PHAVU_005G071400g) mRNA, 
complete cds
Length=503

 Score = 109 bits (272),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQE-IAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS AGLC LFLVLFVAQE +  TEA+TCE+LADT+RGPCF  G+CDDHCKNK HL+ 
Sbjct  38   MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLR  217

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  218  GRCRDDFRCWCTRNC*  265


>LN913083.1 Vigna radiata mRNA for defensin protein (PDF1 gene), cultivar 
DX22
Length=228

 Score = 106 bits (265),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS+AGLC LFLVLFVAQE+ V TE +TCE LA+TYRGPCFT  SCDDHC+ K H+ S
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEVMVQTEVKTCEKLANTYRGPCFTTDSCDDHCEIKEHMRS  180

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  181  GRCRDDFRCWCTRNC*  228


>LN901493.1 Vigna radiata PDF1 gene for defensin protein, cultivar DX22
Length=228

 Score = 106 bits (265),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKKS+AGLC LFLVLFVAQE+ V TE +TCE LA+TYRGPCFT  SCDDHC+ K H+ S
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEVMVQTEVKTCEKLANTYRGPCFTTDSCDDHCEIKEHMRS  180

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  181  GRCRDDFRCWCTRNC*  228


>EU920046.1 Vicia faba clone 016 E08 defensin-like protein mRNA, complete 
cds
Length=225

 Score = 105 bits (263),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKK++A L  LFLVLFVAQEIAV+EA+TCE+L+DT++GPC  +G+C+ HCKN  HL+SG
Sbjct  1    MEKKAVAALSFLFLVLFVAQEIAVSEAKTCENLSDTFKGPCIPDGNCNKHCKNNEHLLSG  180

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+NC*
Sbjct  181  RCRDDFRCWCTRNC*  225


>EU920045.1 Vicia faba clone 011 F07 defensin-like protein mRNA, complete 
cds
Length=225

 Score = 105 bits (263),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKK++A L  LFLVLFVAQEIAV+EA+TCE+L+DT++GPC  +G+C+ HCKN  HL+SG
Sbjct  1    MEKKAVAALSFLFLVLFVAQEIAVSEAKTCENLSDTFKGPCIPDGNCNKHCKNNEHLLSG  180

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+NC*
Sbjct  181  RCRDDFRCWCTRNC*  225


>XM_016081189.1 PREDICTED: Arachis duranensis defensin-1-like (LOC107462579), 
mRNA
Length=477

 Score = 108 bits (270),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +3

Query  1    MEKKSIAGLCLLFLVLFVAQE-IAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKK++AG C+ FLVLF+AQE +  TEA+ C HLADTYRGPCFT  SCDDHCKNK H +S
Sbjct  243  MEKKTVAGFCIFFLVLFLAQEGVVKTEAKLCNHLADTYRGPCFTNASCDDHCKNKEHFVS  422

Query  60   GTCHNFQCFCTQNC*  74
            GTC    C+C  NC*
Sbjct  423  GTCMKMACWCAHNC*  467


>JQ314215.1 Clitoria ternatea defensin mRNA, complete cds
Length=228

 Score = 105 bits (261),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            M+KKS+AGLC LFLVLFVAQE+ V TEA+TCE+LAD +RG C   G+CDDHCKNK HL+S
Sbjct  1    MDKKSLAGLCFLFLVLFVAQEVVVQTEAKTCENLADAFRGLCIATGNCDDHCKNKEHLVS  180

Query  60   GTCH-NFQCFCTQNC*  74
            G C  + +C+CT+NC*
Sbjct  181  GRCRDDLRCWCTKNC*  228


>XR_001614224.1 PREDICTED: Arachis ipaensis uncharacterized LOC107613898 (LOC107613898), 
ncRNA
Length=652

 Score = 108 bits (271),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQE-IAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            MEKK++AG C+ FLVLF+AQE +  TEA+ C HLADTYRGPCFT  SCDDHCKNK H +S
Sbjct  254  MEKKTVAGFCIFFLVLFLAQEGVVKTEAKLCNHLADTYRGPCFTNASCDDHCKNKEHFVS  433

Query  60   GTCHNFQCFCTQNC*  74
            GTC    C+C  NC*
Sbjct  434  GTCMKMACWCAHNC*  478


>AY681973.1 Medicago sativa putative defensin 2.1 precursor (Def2.1) gene, 
complete cds
Length=564

 Score = 107 bits (267),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  19   AQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCHNFQCFCTQNC*  74
            A+EI VTEARTCEHLADTYRGPCFT+ SCDDHCKNKAHLISGTCH  QCFCTQNC*
Sbjct  397  AEEIVVTEARTCEHLADTYRGPCFTDASCDDHCKNKAHLISGTCHRLQCFCTQNC*  564


>JX424594.1 Arachis hypogaea low molecular weight cysteine-rich protein 68 
mRNA, complete cds
Length=228

 Score = 102 bits (255),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            M  KS+ G C + L+L VAQE+ V +EA TCE+LADTYRGPCFT GSCDDHCKNK HL+S
Sbjct  1    MAGKSLTGFCFILLLLVVAQEMVVQSEAATCENLADTYRGPCFTTGSCDDHCKNKEHLLS  180

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  181  GRCRDDFRCWCTRNC*  228


>AY182164.1 Arachis diogoi antifungal protein defensin mRNA, complete cds
 AY206395.1 Cicer arietinum defensin mRNA, complete cds
Length=219

 Score = 102 bits (255),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKKS+AGLC LFLVLFVAQEI VTEA+TCE+LAD YRGPCF+   CD HC  K H +SG
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKEHAVSG  174

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+ C*
Sbjct  175  RCRDDFRCWCTKRC*  219


>AY227192.1 Trigonella foenum-graecum defensin mRNA, complete cds
 AY244556.1 Cajanus cajan defensin mRNA, complete cds
Length=219

 Score = 102 bits (255),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKKS+AGLC LFLVLFVAQEI VTEA+TCE+LAD YRGPCF+   CD HC  K H +SG
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKEHAVSG  174

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+ C*
Sbjct  175  RCRDDFRCWCTKRC*  219


>DQ296045.1 Arachis hypogaea disease resistance response protein mRNA, partial 
cds
Length=225

 Score = 102 bits (254),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            M  KS+ G C + L+L VAQE+ V +EA TCE+LADTYRGPCFT GSCDDHCKNK HL+S
Sbjct  1    MAGKSLTGFCFILLLLVVAQEMVVQSEAATCENLADTYRGPCFTTGSCDDHCKNKEHLLS  180

Query  60   GTCH-NFQCFCTQNC  73
            G C  +F+C+CT+NC
Sbjct  181  GRCRDDFRCWCTRNC  225


>EF194158.1 Lens culinaris subsp. culinaris defensin precursor, mRNA, complete 
cds
Length=455

 Score = 104 bits (259),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKK++A L  LF+VLFVAQEIAVTEA+TCE+L+D+++GPC  +G+C+ HCK K HL+SG
Sbjct  31   MEKKTVAALSFLFIVLFVAQEIAVTEAKTCENLSDSFKGPCIPDGNCNKHCKEKEHLLSG  210

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+NC*
Sbjct  211  RCRDDFRCWCTRNC*  255


>L01579.1 Pisum sativum disease resistance response protein 39 (DRR230-b) 
mRNA, complete cds
 X52224.1 P.sativum pI39 mRNA
Length=456

 Score = 104 bits (259),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  19   AQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCHNFQCFCTQNC*  74
            AQEI VTEA TCEHLADTYRG CFT  SCDDHCKNKAHLISGTCH+++CFCTQNC*
Sbjct  126  AQEIVVTEANTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHDWKCFCTQNC*  293


>KF498667.1 Synthetic construct defensin 2/antifungal protein 2 fusion protein 
gene, complete cds
Length=495

 Score = 103 bits (258),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKKS+AGLC LFLVLFVAQEI VTEA+TCE+LAD YRGPCF+   CD HC  K H +SG
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKEHAVSG  174

Query  61   TCH-NFQCFCTQNC  73
             C  +F+C+CT+ C
Sbjct  175  RCRDDFRCWCTKRC  216


>AY681971.1 Medicago sativa putative defensin 1.2 precursor (Def1.2) gene, 
complete cds
Length=219

 Score = 100 bits (249),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKKS+AGLC LFLVLFVAQEI VTEA+TCE+LAD YRGPCF+   CD HC  K + +SG
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKENAVSG  174

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+ C*
Sbjct  175  RCRDDFRCWCTKRC*  219


>AY288448.1 Arachis diogoi defensin mRNA, complete cds
 AY182163.1 Trigonella foenum-graecum antifungal protein defensin mRNA, complete 
cds
Length=225

 Score = 100 bits (248),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKKS+A L  LFLVLFV QEI VTEA TCE+LADT+RGPCF   +C+ HCK K HL+SG
Sbjct  1    MEKKSLAALSFLFLVLFVTQEIVVTEAATCENLADTFRGPCFGNSNCNFHCKTKEHLLSG  180

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+ C*
Sbjct  181  RCRDDFRCWCTKRC*  225


>AF319468.1 Medicago sativa antifungal protein precursor, mRNA, complete 
cds
Length=406

 Score = 102 bits (253),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = +3

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKKS+AGLC LFLVLFVAQEI VTEARTCE+LAD YRGPCF+   CD HC  K + +SG
Sbjct  75   MEKKSLAGLCFLFLVLFVAQEIVVTEARTCENLADKYRGPCFS--GCDTHCTTKENAVSG  248

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+ C*
Sbjct  249  RCRDDFRCWCTKRC*  293


>XM_016081261.1 PREDICTED: Arachis duranensis defensin-like protein (LOC107462635), 
mRNA
Length=545

 Score = 102 bits (255),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            M  KS+ G C + L+L VAQE+ V +EA TCE+LADTYRGPCFT GSCDDHCKNK HL+S
Sbjct  73   MAGKSLTGFCFILLLLVVAQEMVVQSEAATCENLADTYRGPCFTTGSCDDHCKNKEHLLS  252

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  253  GRCRDDFRCWCTRNC*  300


>XM_013609260.1 Medicago truncatula Defensin MtDef1.1/MtDef1.2 mRNA
Length=428

 Score = 101 bits (252),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKK++AGLC LFLVLFVAQEI VTEA+TCE+LAD YRGPCF+   CD HC  K + +SG
Sbjct  43   MEKKTLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKENAVSG  216

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+NC*
Sbjct  217  RCRDDFRCWCTKNC*  261


>XM_016316566.1 PREDICTED: Arachis ipaensis defensin-like protein (LOC107614352), 
mRNA
Length=569

 Score = 102 bits (255),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            M  KS+ G C + L+L VAQE+ V +EA TCE+LADTYRGPCFT GSCDDHCKNK HL+S
Sbjct  80   MAGKSLTGFCFILLLLVVAQEMVVQSEAATCENLADTYRGPCFTTGSCDDHCKNKEHLLS  259

Query  60   GTCH-NFQCFCTQNC*  74
            G C  +F+C+CT+NC*
Sbjct  260  GRCRDDFRCWCTRNC*  307


>AF525685.1 Pisum sativum antimicrobial defensin peptide DRR230-c (DRR230-c) 
mRNA, partial cds
Length=180

 Score = 95.1 bits (235),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  18   VAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCHNFQC  67
            VAQEI VTEA TCEHLADTYRG CFT+ SCDDHCKNKAHLISGTCHNF+C
Sbjct  31   VAQEIVVTEANTCEHLADTYRGVCFTDASCDDHCKNKAHLISGTCHNFKC  180


>AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete 
sequence, cultivar: Shumari
Length=33495452

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 65/110 (59%), Gaps = 36/110 (33%)
 Frame = -1

Query  1         MEKKSIAGLCLLFLVLFVAQE-----------------------------------IAVT  25
                 MEKKS+AGLC LFLVLFVA++                                   +  T
Sbjct  14041556  MEKKSLAGLCFLFLVLFVARKSLLLCSFFRMILYL*W*ILYNRMSLTYVFEQAEEVVVQT  14041377

Query  26        EARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCTQNC*  74
                 EARTCE+LA++YRGPC T GSCDDHCKNK HL SG C  +F+C+CT+NC*
Sbjct  14041376  EARTCENLANSYRGPCITTGSCDDHCKNKEHLNSGRCRDDFRCWCTKNC*  14041227


>DQ342338.1 Cicer arietinum defensin (AFP) gene, promoter region and complete 
cds
Length=1050

 Score = 89.4 bits (220),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = +1

Query  17    FVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCTQNC*  74
               A+EIAV+EA  CE+LADTYRGPCFT GSCDDHCKNK HL+SG C  +F+C+CT+NC*
Sbjct  874   IYAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC*  1050


 Score = 37.4 bits (85),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  1    MEKKSIAGLCLLFLVLFVAQEI  22
            M+KKS+AGLC LFLVLFVA++I
Sbjct  747  MDKKSLAGLCFLFLVLFVARKI  812


>AF139018.1 Pisum sativum disease resistance response protein 230 precursor 
(DRR230) mRNA, complete cds
Length=363

 Score = 85.5 bits (210),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKKS+A L  L LVLF+AQEI V+EA TCE+LA +Y+G CF  G CD HC+ +   ISG
Sbjct  56   MEKKSLACLSFLLLVLFIAQEIVVSEANTCENLAGSYKGVCF--GGCDRHCRTQEGAISG  229

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+NC*
Sbjct  230  RCRDDFRCWCTKNC*  274


>AY560900.1 Medicago sativa putative defensin 3.2 (Def3.2) gene, complete 
cds
Length=1004

 Score = 89.7 bits (221),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +3

Query  12    LFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCT  70
             + ++   A+EI VTEA+TCE+LADT+RGPCFT G+CDDHCKNK HL+SG C  +F+C+CT
Sbjct  813   MSML*IYAEEIVVTEAKTCENLADTFRGPCFTNGACDDHCKNKEHLVSGRCRDDFRCWCT  992

Query  71    QNC*  74
             +NC*
Sbjct  993   RNC*  1004


>AY560901.1 Medicago truncatula putative defensin 3.1 (Def3.1) gene, complete 
cds
Length=318

 Score = 84.7 bits (208),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 61/108 (56%), Gaps = 36/108 (33%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVA---------------------------------QEIAVTEA  27
            MEKKS+AGLC LFLVLFVA                                 +EI VTEA
Sbjct  1    MEKKSLAGLCFLFLVLFVARN*VHHSYH*SYSAFVISSYILYFNIIVMFINAEEIVVTEA  180

Query  28   RTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCTQNC*  74
            +TCE+LAD YRGPCF+   CD HC  K + +SG C  +F+C+CT+NC*
Sbjct  181  KTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCTRNC*  318


>JX424606.1 Arachis hypogaea low molecular weight cysteine-rich protein 68 
gene, complete cds
Length=687

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +1

Query  13   FLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCTQ  71
             +++ V + +  +EA TCE+LADTYRGPCFT GSCDDHCKNK HL+SG C  +F+C+CT+
Sbjct  499  LMLVRVEEMVVQSEAATCENLADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDFRCWCTR  678

Query  72   NC*  74
            NC*
Sbjct  679  NC*  687


>KJ939334.1 Phaseolus vulgaris cultivar polesta defensin (pdf) gene, complete 
cds
Length=486

 Score = 84.3 bits (207),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = +1

Query  12   LFLVLFVAQEIAV--TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCF  68
            + + LF   E  V  TEA+TCE+LADTYRGPCFT GSCDDHCKNK HL+SG C  +F+C+
Sbjct  289  MLMNLFEHAEECVLQTEAKTCENLADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDFRCW  468

Query  69   CTQNC*  74
            CT+NC*
Sbjct  469  CTKNC*  486


>AY313166.1 Medicago truncatula defensin (Def1) gene, complete cds
 AY681972.1 Medicago sativa putative defensin 1.1 precursor (Def1.1) gene, 
complete cds
Length=318

 Score = 82.8 bits (203),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 60/108 (56%), Gaps = 36/108 (33%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVA---------------------------------QEIAVTEA  27
            MEKKS+AGLC LFLVLFVA                                 +EI VTEA
Sbjct  1    MEKKSLAGLCFLFLVLFVARN*VHHSYH*SYSAFVISSYILYFNIIVMFINAEEIVVTEA  180

Query  28   RTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCTQNC*  74
            +TCE+LAD YRGPCF+   CD HC  K + +SG C  +F+C+CT+ C*
Sbjct  181  KTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCTKRC*  318


>LN901494.1 Vigna radiata PDF1 gene intron, cultivar Dautam
Length=356

 Score = 81.6 bits (200),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +3

Query  12   LFLVLFV-AQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCF  68
            + + LF  A+E+ V TEA+TCE+LA+TYRGPCF  GSCDDHCKNK HL SG C  +F+C+
Sbjct  159  MRISLFEHAEEVMVQTEAKTCENLANTYRGPCFPTGSCDDHCKNKEHLRSGRCRDDFRCW  338

Query  69   CTQNC*  74
            CT+NC*
Sbjct  339  CTRNC*  356


>AY679170.1 Pachyrhizus erosus defensin (spe10) mRNA, partial cds
Length=141

 Score = 76.3 bits (186),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +1

Query  28   RTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCTQNC  73
            +TCE+LADT+RGPCFT+GSCDDHCKNK HLI G C  +F+C+CT+NC
Sbjct  1    KTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC  141


>FJ380052.1 Vigna unguiculata defensin mRNA, partial cds
Length=144

 Score = 75.5 bits (184),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +1

Query  28   RTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCTQNC*  74
            +TCE+LADTYRGPCFT GSCDDHCKNK HL+SG C  + +C+CT+NC*
Sbjct  1    KTCENLADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDVRCWCTRNC*  144


>AY560899.1 Medicago sativa putative defensin 3.1 (Def3.1) gene, complete 
cds
Length=495

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 6/75 (8%)
 Frame = +1

Query  4    KSIAGLCL---LFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            + I  LC+   L+  L  A+EI VTEA TCE+LA+TYRGPCF  G CD HCK K HL+SG
Sbjct  277  RQIKHLCIIQYLYCYLVDAEEIMVTEAATCENLANTYRGPCF--GGCDFHCKTKEHLLSG  450

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+NC*
Sbjct  451  RCRDDFRCWCTRNC*  495


>LN901495.1 Vigna radiata PDF1 gene intron, cultivar DX22
Length=356

 Score = 73.6 bits (179),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = +3

Query  11   LLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCF  68
            +   +L  A+E+ V TE +TCE LA+TYRGPCFT  SCDDHC+ K H+ SG C  +F+C+
Sbjct  159  MRMSLLEHAKEVMVQTEVKTCEKLANTYRGPCFTTDSCDDHCEIKEHMRSGRCRDDFRCW  338

Query  69   CTQNC*  74
            CT+NC*
Sbjct  339  CTRNC*  356


>AY571902.1 Medicago truncatula cultivar Jemalong Def3.1 (Def3.1) gene, partial 
cds
Length=2053

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +3

Query  11    LLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFC  69
             ++ +V   A+EI VTEA TCE+LA T+RGPCF   +CD HC+ K HL+SG C  +F+C+C
Sbjct  1395  VVVIVYLDAEEIVVTEANTCENLAGTFRGPCFGNSNCDFHCRTKEHLVSGRCRDDFRCWC  1574

Query  70    TQNC*  74
             T+NC*
Sbjct  1575  TRNC*  1589


>XR_001614223.1 PREDICTED: Arachis ipaensis uncharacterized LOC107613897 (LOC107613897), 
ncRNA
Length=614

 Score = 74.3 bits (181),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 3/75 (4%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKK +AG C+ FL+LF+AQE  V E + C +L+D ++GPC    +CD HC++  HL+SG
Sbjct  140  MEKK-MAGFCIFFLILFLAQEYGV-EGKECLNLSDKFKGPCLGSKNCDHHCRDIEHLLSG  313

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+C + C*
Sbjct  314  VCRDDFRCWCNRKC*  358


>AF535089.1 Trigonella foenum-graecum defensin gene, complete cds
Length=701

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 3/63 (5%)
 Frame = +3

Query  13   FLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCTQ  71
             +V+  A+EI VTEA+TCE+LAD YRGPCF+   CD HC  K H +SG C  +F+C+CT+
Sbjct  519  IVVMVHAEEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKEHAVSGRCRDDFRCWCTK  692

Query  72   NC*  74
             C*
Sbjct  693  RC*  701


>AY681970.1 Medicago sativa putative defensin 1.3 precursor (Def1.3) gene, 
complete cds
Length=786

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = +1

Query  13   FLVLFV-AQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCT  70
             +V+F+ A+EI VTEARTCE+LAD YRGPCF+   CD HC  K + +SG C  +F+C+CT
Sbjct  601  IVVMFINAEEIVVTEARTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCT  774

Query  71   QNC*  74
            + C*
Sbjct  775  KRC*  786


>AY681967.1 Medicago sativa putative defensin 1.6 precursor (Def1.6) gene, 
complete cds
Length=745

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = +2

Query  13   FLVLFV-AQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCT  70
             +V+F+ A+EI VTEARTCE+LAD YRGPCF+   CD HC  K + +SG C  +F+C+CT
Sbjct  560  IVVIFINAEEIVVTEARTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCT  733

Query  71   QNC*  74
            + C*
Sbjct  734  KRC*  745


>AY681969.1 Medicago sativa putative defensin 1.4 precursor (Def1.4) gene, 
complete cds
Length=793

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = +2

Query  13   FLVLFV-AQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCT  70
             +V+F+ A+EI VTEARTCE+LAD YRGPCF+   CD HC  K + +SG C  +F+C+CT
Sbjct  608  IVVMFINAEEIVVTEARTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCT  781

Query  71   QNC*  74
            + C*
Sbjct  782  KRC*  793


>L01578.1 Pea (pi230) disease resistance response protein 230 (DRR230-a) 
mRNA, complete cds
 X52225.1 P.sativum pI230 mRNA
Length=468

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = +3

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            MEKKS+A L  L LVLFVAQEI V+EA TCE+LA +Y+G CF  G CD HC+ +   ISG
Sbjct  78   MEKKSLACLSFLLLVLFVAQEIVVSEANTCENLAGSYKGVCF--GGCDRHCRTQEGAISG  251

Query  61   TCH-NFQCFCTQNC*  74
             C  +F+C+CT+NC*
Sbjct  252  RCRDDFRCWCTKNC*  296


>AY681968.1 Medicago sativa putative defensin 1.5 precursor (Def1.5) gene, 
complete cds
Length=679

 Score = 69.7 bits (169),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 4/64 (6%)
 Frame = +2

Query  13   FLVLFV-AQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCT  70
             +V+F+ A+EI V EARTCE+LAD YRGPCF+   CD HC  K + +SG C  +F+C+CT
Sbjct  494  IVVIFINAEEIVVIEARTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCT  667

Query  71   QNC*  74
            + C*
Sbjct  668  KRC*  679


>KF672189.1 Sophora chathamica microsatellite Sop-807 sequence
Length=1027

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +1

Query  34   ADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCTQNC*  74
            ADTYRGPCFT GSCDDHCKNK HL+SG C  +F+C+CT+NC*
Sbjct  742  ADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDFRCWCTRNC*  867


>XM_013597344.1 Medicago truncatula Nodule Cysteine-Rich (NCR) secreted peptide 
partial mRNA
Length=258

 Score = 60.5 bits (145),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 45/86 (52%), Gaps = 12/86 (14%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLAD--------TYRG---PCFTEGSCDD  49
            MEKKS+A LC LFLV FV ++  V E R  E L+D        T+ G   P F    CD 
Sbjct  1    MEKKSLAELCFLFLVFFVTKKNVVIETRASEVLSDGVCMSLSGTFNGLCIPPFMNNRCDK  180

Query  50   HCKNKAHLISGTC-HNFQCFCTQNC*  74
             CKNK H   G C  + +C+C   C*
Sbjct  181  SCKNKEHKYYGKCWQDLRCWCYGEC*  258


>XM_006423263.1 Citrus clementina hypothetical protein (CICLE_v10029711mg) mRNA, 
complete cds
Length=512

 Score = 61.2 bits (147),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 4/71 (6%)
 Frame = +2

Query  8    GLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH----  63
             L   F +LF + E+ V EA+ C   A  + GPC   GSC +HC+ +   + G CH    
Sbjct  47   ALIFAFFILFASFEMPVAEAKQCSKRAQKWTGPCIKTGSCRNHCRKREGAVDGACHYDFP  226

Query  64   NFQCFCTQNC*  74
             F CFC  NC*
Sbjct  227  GFACFCYYNC*  259


>FJ948813.2 Nicotiana megalosiphon putative defensin mRNA, complete cds
Length=219

 Score = 56.2 bits (134),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            M++ ++  LC ++LVLFVAQEI VTEAR C+  A    G CF + +C   C+ +A    G
Sbjct  1    MDRVALVSLCFVYLVLFVAQEIVVTEARECK--AQGRHGTCFRDANCVQVCEKQAGWSHG  174

Query  61   TCH-NFQCFCTQNC*  74
             C   F+C C   C*
Sbjct  175  DCRAQFKCKCIFEC*  219


>XM_010676850.1 PREDICTED: Beta vulgaris subsp. vulgaris defensin-like protein 
1 (LOC104891192), transcript variant X1, mRNA
Length=610

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +3

Query  4    KSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH  63
            + + GLC+LFLVLF + E+   E R C+  +  ++GPC  + +C   C+N+     G CH
Sbjct  102  RRLFGLCILFLVLFASPEVKQAEGRVCQSRSHYFKGPCARDHNCAYVCRNEG-FSGGRCH  278

Query  64   NF--QCFCTQNC*  74
             F  +C+CT+ C*
Sbjct  279  GFFRRCYCTRLC*  317


>XM_003630374.2 Medicago truncatula Defensin MtDef4.7 mRNA
Length=409

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            ME+K++  L +LFLVL     +   E R CE  +  ++GPC ++ +C   C+ +   I G
Sbjct  28   MERKTLGILFMLFLVLAADVAVKTAEGRRCESQSHKFKGPCVSDSNCGSVCRGEG-FIGG  204

Query  61   TCHNF--QCFCTQNC*  74
             C     +CFCT+NC*
Sbjct  205  DCRGVRHRCFCTRNC*  252


>XM_012216514.1 PREDICTED: Jatropha curcas defensin-like protein 19 (LOC105633828), 
mRNA
Length=295

 Score = 54.7 bits (130),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 6/80 (8%)
 Frame = +1

Query  1    MEKKSIAGLCLL--FLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLI  58
            M K   + LC L  FL L V++E+AVTEA+ C+  + T+ G C   G C+  C+N     
Sbjct  1    MAKLHSSALCFLIIFLFLLVSKEMAVTEAKLCQRRSKTWSGFCGDPGKCNRQCRNWEGAS  180

Query  59   SGTCH----NFQCFCTQNC*  74
             G CH     F CFC   C*
Sbjct  181  HGACHAQFPGFACFCYFKC*  240


>XM_010066325.1 PREDICTED: Eucalyptus grandis defensin-like protein 19 (LOC104451728), 
mRNA
Length=336

 Score = 52.4 bits (124),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 34/67 (51%), Gaps = 4/67 (6%)
 Frame = +1

Query  11   LLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH----NFQ  66
            L    L ++ E+A+ E + CE  + T+ G C   G+CD  CKN     SG CH     F 
Sbjct  46   LSIFSLLISTEMAMVEGKLCERRSKTWSGFCGNSGNCDRQCKNWEGARSGACHAQSLGFA  225

Query  67   CFCTQNC  73
            CFC  NC
Sbjct  226  CFCYFNC  246


>XM_006495244.2 PREDICTED: Citrus sinensis defensin-like protein 1 (LOC102607346), 
mRNA
Length=552

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 35/71 (49%), Gaps = 4/71 (6%)
 Frame = +1

Query  8    GLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCHN---  64
             L   F +LF + E+ + EA+ C+  + T+ GPC   G C  HCK +     G C+    
Sbjct  79   ALIFAFFILFASFEVPMAEAKVCQRRSKTWSGPCLNTGKCSRHCKQQEDARYGACYRQGT  258

Query  65   -FQCFCTQNC*  74
             + CFC   C*
Sbjct  259  GYACFCYFEC*  291


>XM_006423264.1 Citrus clementina hypothetical protein (CICLE_v10029828mg) mRNA, 
complete cds
Length=249

 Score = 51.2 bits (121),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 4/70 (6%)
 Frame = +1

Query  9    LCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH----N  64
            L   F +LF +  + + EA+ C+  + T+ GPC   G C   CK + +   G C+     
Sbjct  40   LIFAFFILFASFGVPMAEAKVCQRRSKTWSGPCLNTGKCSRQCKQQEYARYGACYRQGAG  219

Query  65   FQCFCTQNC*  74
            + C+C  NC*
Sbjct  220  YACYCYFNC*  249


>XM_009760689.1 PREDICTED: Nicotiana sylvestris defensin-like protein 1 (LOC104211603), 
mRNA
Length=294

 Score = 51.6 bits (122),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 38/78 (49%), Gaps = 5/78 (6%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            M  K I  +   FL L  + E+   EA+ C+  + T+ GPC   G+C   CKN+     G
Sbjct  59   MSNKVILAILFCFL-LIASNEMQGGEAKVCQRRSKTWSGPCINTGNCSRQCKNQEDGRFG  235

Query  61   TCH----NFQCFCTQNC*  74
             CH     F CFC  NC*
Sbjct  236  ACHRSGIGFACFCYFNC*  289


>XM_015199257.1 PREDICTED: Solanum pennellii defensin-like protein 1 (LOC107001067), 
mRNA
Length=240

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +1

Query  7    AGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH  63
            A L L+   L  + +I   E+  CE ++ T+ GPCF  G C++ C N  H I G CH
Sbjct  28   AFLALILFFLIASNDIQKAESIGCEKMSVTWSGPCFDTGGCNNQCINWEHAIHGACH  198


>XM_010676851.1 PREDICTED: Beta vulgaris subsp. vulgaris defensin-like protein 
1 (LOC104891192), transcript variant X2, mRNA
Length=609

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  4    KSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH  63
            + + GLC+LFLVLF +Q +   E R C+  +  ++GPC  + +C   C+N+     G CH
Sbjct  104  RRLFGLCILFLVLFASQ-VKQAEGRVCQSRSHYFKGPCARDHNCAYVCRNEG-FSGGRCH  277

Query  64   NF--QCFCTQNC*  74
             F  +C+CT+ C*
Sbjct  278  GFFRRCYCTRLC*  316


>XR_001658616.1 PREDICTED: Nicotiana tabacum uncharacterized LOC107832645 (LOC107832645), 
ncRNA
Length=509

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (54%), Gaps = 5/71 (7%)
 Frame = +2

Query  9    LCLLF-LVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH----  63
            L +LF  +L V+ E+   EA+ C+  + T+ GPC   G+C   CKN+     G CH    
Sbjct  77   LAILFCFLLIVSNEMQGGEAKVCQRRSKTWSGPCINTGNCSRQCKNQEDARFGACHRSGI  256

Query  64   NFQCFCTQNC*  74
             F CFC  NC*
Sbjct  257  GFACFCYFNC*  289


>XR_685286.1 PREDICTED: Nicotiana tomentosiformis uncharacterized LOC104091810 
(LOC104091810), ncRNA
Length=526

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (54%), Gaps = 5/71 (7%)
 Frame = +1

Query  9    LCLLF-LVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH----  63
            L +LF  +L V+ E+   EA+ C+  + T+ GPC   G+C   CKN+     G CH    
Sbjct  94   LAILFCFLLIVSNEMQGGEAKVCQRRSKTWSGPCINTGNCSRQCKNQEDARFGACHRSRI  273

Query  64   NFQCFCTQNC*  74
             F CFC  NC*
Sbjct  274  GFACFCYFNC*  306


>XM_012987705.1 PREDICTED: Erythranthe guttatus defensin-like protein 19 (LOC105963314), 
mRNA
Length=255

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 37/70 (53%), Gaps = 4/70 (6%)
 Frame = +1

Query  9    LCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH----N  64
            L +L L + +  E+ V E+R CE  + T+ G C +  +C++ C+N      G CH     
Sbjct  40   LIVLLLFIMLNNEVMVVESRLCERRSKTWTGFCGSSNNCNNQCRNWERASHGACHAQFPG  219

Query  65   FQCFCTQNC*  74
            F CFC  NC*
Sbjct  220  FACFCYFNC*  249


>XM_010322203.1 PREDICTED: Solanum lycopersicum defensin-like protein 1 (LOC104647220), 
transcript variant X1, mRNA
Length=367

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +2

Query  7    AGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH  63
            A L L+   +  + EI   E+  CE ++ T+ GPCF  G C++ C N  H I G CH
Sbjct  29   AFLALILFFVIASNEIQKAESIGCEKMSVTWSGPCFDTGGCNNQCINWEHAIHGACH  199


>XM_006423265.1 Citrus clementina hypothetical protein (CICLE_v10029712mg) mRNA, 
complete cds
Length=529

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 35/71 (49%), Gaps = 4/71 (6%)
 Frame = +1

Query  8    GLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH----  63
             L   F +LF +  + + EA+ C+  + T+ GPC   G C   CK + +   G C+    
Sbjct  52   ALIFAFFILFASFGVPMAEAKVCQRRSKTWSGPCLNTGKCSRQCKQQEYARYGACYRQGA  231

Query  64   NFQCFCTQNC*  74
             + C+C  NC*
Sbjct  232  GYACYCYFNC*  264


>XR_001643946.1 PREDICTED: Nicotiana tabacum uncharacterized LOC107767584 (LOC107767584), 
ncRNA
Length=501

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 38/78 (49%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            M  K I  +   FL L  + E+   EA+ C+  + T+ GPC   G+C   CKN+     G
Sbjct  46   MSNKVILAILFCFL-LIASNEMQGGEAKVCQRRSKTWSGPCINTGNCSRQCKNQEDGRFG  222

Query  61   TCH----NFQCFCTQNC*  74
             CH     F CFC  NC*
Sbjct  223  ACHRSGIGFACFCYFNC*  276


>XM_013588571.1 Medicago truncatula Defensin-like protein mRNA
Length=559

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 37/73 (51%), Gaps = 4/73 (5%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGS---CDDHCKNKAHL  57
            MEKK++A LC   +VL  AQE AV +   CE  +  + G C        C   C+    L
Sbjct  50   MEKKTLASLCFFLIVLLAAQE-AVVQIEACEKPSKFFSGACIGSSGNQQCGYLCRRGEGL  226

Query  58   ISGTCHNFQCFCT  70
            +SG+C N +C C 
Sbjct  227  LSGSCKNLKCVCA  265


>XM_015226355.1 PREDICTED: Solanum pennellii defensin-like protein 1 (LOC107025580), 
mRNA
Length=442

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 37/78 (47%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            M  K I  L   FL L  + E+ V EA+ C+  + T+ GPC   G+C   CK +     G
Sbjct  37   MNTKLILALMFCFL-LIASNEMQVGEAKVCQRRSKTWSGPCINTGNCSRQCKQQEDARFG  213

Query  61   TCHN----FQCFCTQNC*  74
             CH     F CFC   C*
Sbjct  214  ACHRSGFGFACFCYFKC*  267


>DQ446381.1 Arabidopsis thaliana clone pENTR221-At1g61070 plant defensin-fusion 
protein (At1g61070) mRNA, complete cds
Length=231

 Score = 48.9 bits (115),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = +1

Query  7    AGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCHNF-  65
            + L LLF++L     +   EARTCE  ++ + GPC +  +C + C N+     G C  F 
Sbjct  25   SALLLLFMILATVMGLVTVEARTCETSSNLFNGPCLSSSNCANVCHNEG-FSDGDCRGFR  201

Query  66   -QCFCTQNC*  74
             +C CT+ C*
Sbjct  202  RRCLCTRPC*  231


>XM_004242803.2 PREDICTED: Solanum lycopersicum defensin-like protein 1 (LOC101244389), 
mRNA
Length=469

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 36/71 (51%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    LCLLFLVLFVA-QEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH----  63
            L LLF  L VA  E+ V EA+ C+  + T+ GPC   G+C   CK +     G CH    
Sbjct  69   LALLFCFLLVASNEMQVGEAKVCQRRSKTWSGPCINTGNCSRQCKQQEDARFGACHRSGF  248

Query  64   NFQCFCTQNC*  74
             F CFC   C*
Sbjct  249  GFACFCYFKC*  281


>EF145035.1 Populus trichocarpa clone WS0111_K17 unknown mRNA
Length=585

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAV-TEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            ME K   GL  L L++  +QE+ V TEAR C+  +  ++GPC  + +C   C+N+     
Sbjct  38   MEIKRSFGLFFLLLIVLASQEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEG-FSG  214

Query  60   GTCHNF--QCFCTQNC*  74
            G C  F  +CFCT+ C*
Sbjct  215  GRCKGFRRRCFCTKLC*  265


>XR_742235.1 PREDICTED: Solanum lycopersicum uncharacterized LOC101244679 
(LOC101244679), ncRNA
Length=494

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 37/78 (47%), Gaps = 5/78 (6%)
 Frame = +2

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            M  K I  L   FL L  + E+ V EA+ C+  + T+ GPC   G+C   CK +     G
Sbjct  59   MNTKLILALMFCFL-LIASNEMQVGEAKVCQRRSKTWSGPCINTGNCSRQCKQQEDARFG  235

Query  61   TCHN----FQCFCTQNC*  74
             CH     F CFC   C*
Sbjct  236  ACHRSGFGFACFCYFKC*  289


>XM_010321070.1 PREDICTED: Solanum lycopersicum defensin Ec-AMP-D2-like (LOC101255877), 
mRNA
Length=341

 Score = 49.3 bits (116),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 7/77 (9%)
 Frame = +3

Query  4    KSIAG----LCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLIS  59
            K++AG    L   FLVL +     +TEARTCE  +  Y+GPC  + +C + CK +     
Sbjct  45   KNMAGFKKLLATFFLVLMLVFAAELTEARTCESQSHRYKGPCVRKNNCANVCKTEG-FSG  221

Query  60   GTCHNF--QCFCTQNC*  74
            G C  F  +CFC ++C*
Sbjct  222  GHCRGFRRRCFCAKHC*  272


>DQ652906.1 Arabidopsis thaliana clone 0000019027_0000013118 unknown mRNA
Length=231

 Score = 48.5 bits (114),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +1

Query  7    AGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCHNF-  65
            + L LLF++L     +   EARTCE  ++ + GPC +  +C + C N+     G C  F 
Sbjct  25   SALLLLFMILATVMGLVTVEARTCETSSNLFNGPCLSSSNCANVCHNEG-FSDGDCRGFR  201

Query  66   -QCFCTQNC  73
             +C CT+ C
Sbjct  202  RRCLCTRPC  228


>XM_015305081.1 PREDICTED: Solanum tuberosum defensin-like protein 19 (LOC107058873), 
mRNA
Length=171

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 29/53 (55%), Gaps = 4/53 (8%)
 Frame = +1

Query  26   EARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH----NFQCFCTQNC*  74
            EAR CE  + T+ GPCF  G+C+  C N  H  SG CH       CFC  NC*
Sbjct  13   EARVCERRSSTWSGPCFDTGNCNRQCINWEHASSGACHREGIGSACFCYFNC*  171


>XM_015226472.1 PREDICTED: Solanum pennellii defensin-like protein 1 (LOC107025719), 
mRNA
Length=231

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 37/78 (47%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  60
            M  K I  L + FL L  + E+   EA+ C   + T+ G C   G+C+  C    H  SG
Sbjct  1    MNSKVILALLVCFL-LIASNEMQGGEAKVCGRRSSTWSGLCLNTGNCNTQCIKWEHASSG  177

Query  61   TCH----NFQCFCTQNC*  74
             CH     F CFC  NC*
Sbjct  178  ACHRDGFGFACFCYFNC*  231



Lambda      K        H
   0.336    0.142    0.500 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1063347184796


  Database: Nucleotide collection (nt)
    Posted date:  Oct 4, 2016  2:28 PM
  Number of letters in database: 128,339,311,604
  Number of sequences in database:  39,204,206



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40