TBLASTN 2.5.0+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.



Database: Nucleotide collection (nt)
           39,204,206 sequences; 128,339,311,604 total letters



Query= 
Length=75
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DQ288897.2  Cicer arietinum defensin (AFP-Ca) mRNA, complete cds      153     2e-47
XM_004487638.2  PREDICTED: Cicer arietinum defensin-like protein ...  152     1e-45
AY907349.1  Tephrosia villosa defensin mRNA, complete cds             137     5e-41
BT090977.1  Soybean clone JCVI-FLGm-5F24 unknown mRNA                 136     3e-39
XM_003543198.3  PREDICTED: Glycine max defensin-like protein (LOC...  136     5e-39
X16877.1  Vigna unguiculata cDNA for stored cotyledon mRNA            134     7e-39
AB020613.1  Vigna radiata mRNA for PDF1, complete cds                 135     8e-39
XM_014636686.1  PREDICTED: Vigna radiata var. radiata defensin-li...  135     9e-39
HM240258.1  Phaseolus vulgaris cultivar BAT93 defensin D1 mRNA, c...  135     9e-39
JQ314214.1  Psophocarpus tetragonolobus defensin mRNA, complete cds   130     2e-38
XM_007149386.1  Phaseolus vulgaris hypothetical protein (PHAVU_00...  134     4e-38
XM_017568810.1  PREDICTED: Vigna angularis defensin-like protein ...  132     7e-38
LN913082.1  Vigna radiata mRNA for defensin protein (PDF1 gene), ...  129     1e-37
LN901492.1  Vigna radiata PDF1 gene for defensin protein, cultiva...  129     1e-37
JX424594.1  Arachis hypogaea low molecular weight cysteine-rich p...  127     3e-37
JQ314215.1  Clitoria ternatea defensin mRNA, complete cds             127     4e-37
DQ296045.1  Arachis hypogaea disease resistance response protein ...  127     5e-37
XM_016081261.1  PREDICTED: Arachis duranensis defensin-like prote...  127     8e-36
XM_016316566.1  PREDICTED: Arachis ipaensis defensin-like protein...  127     9e-36
XM_007149387.1  Phaseolus vulgaris hypothetical protein (PHAVU_00...  126     2e-35
LN913083.1  Vigna radiata mRNA for defensin protein (PDF1 gene), ...  123     2e-35
LN901493.1  Vigna radiata PDF1 gene for defensin protein, cultiva...  123     2e-35
EU920046.1  Vicia faba clone 016 E08 defensin-like protein mRNA, ...  122     7e-35
EU920045.1  Vicia faba clone 011 F07 defensin-like protein mRNA, ...  122     7e-35
AY288448.1  Arachis diogoi defensin mRNA, complete cds                121     1e-34
AY182164.1  Arachis diogoi antifungal protein defensin mRNA, comp...  120     2e-34
AY227192.1  Trigonella foenum-graecum defensin mRNA, complete cds     120     2e-34
KF498667.1  Synthetic construct defensin 2/antifungal protein 2 f...  122     5e-34
AY681971.1  Medicago sativa putative defensin 1.2 precursor (Def1...  118     2e-33
XM_013609260.1  Medicago truncatula Defensin MtDef1.1/MtDef1.2 mRNA   119     4e-33
EF194158.1  Lens culinaris subsp. culinaris defensin precursor, m...  118     1e-32
AF319468.1  Medicago sativa antifungal protein precursor, mRNA, c...  117     2e-32
DQ342338.1  Cicer arietinum defensin (AFP) gene, promoter region ...  120     3e-31
EU920048.1  Vicia faba clone 042 D02 defensin-like protein mRNA, ...  111     9e-31
EU920047.1  Vicia faba clone 039 F05 defensin-like protein mRNA, ...  109     5e-30
EU920044.1  Vicia faba clone 004 C04 defensin-like protein mRNA, ...  109     5e-30
AP015040.1  Vigna angularis var. angularis DNA, chromosome 7, alm...  116     1e-28
JX424606.1  Arachis hypogaea low molecular weight cysteine-rich p...  110     2e-28
FJ174689.1  Pisum sativum pathogenesis-related protein mRNA, comp...  107     5e-28
AF139018.1  Pisum sativum disease resistance response protein 230...  106     5e-28
AY560901.1  Medicago truncatula putative defensin 3.1 (Def3.1) ge...  103     3e-27
KJ939334.1  Phaseolus vulgaris cultivar polesta defensin (pdf) ge...  105     4e-27
AY313166.1  Medicago truncatula defensin (Def1) gene, complete cds    102     1e-26
AY560900.1  Medicago sativa putative defensin 3.2 (Def3.2) gene, ...  107     3e-26
LN901494.1  Vigna radiata PDF1 gene intron, cultivar Dautam           100     8e-26
AY560899.1  Medicago sativa putative defensin 3.1 (Def3.1) gene, ...  100     4e-25
XM_016081189.1  PREDICTED: Arachis duranensis defensin-1-like (LO...  98.6    2e-24
XM_013609259.1  Medicago truncatula Defensin MtDef2.1 mRNA            98.2    2e-24
FJ380052.1  Vigna unguiculata defensin mRNA, partial cds              94.4    4e-24
XR_001614224.1  PREDICTED: Arachis ipaensis uncharacterized LOC10...  98.6    5e-24
AY679170.1  Pachyrhizus erosus defensin (spe10) mRNA, partial cds     91.3    6e-23
LN901495.1  Vigna radiata PDF1 gene intron, cultivar DX22             90.5    7e-22
AY571902.1  Medicago truncatula cultivar Jemalong Def3.1 (Def3.1)...  95.5    2e-21
AF535089.1  Trigonella foenum-graecum defensin gene, complete cds     91.3    5e-21
XR_001614223.1  PREDICTED: Arachis ipaensis uncharacterized LOC10...  89.4    2e-20
L01578.1  Pea (pi230) disease resistance response protein 230 (DR...  87.4    3e-20
AY313169.1  Medicago truncatula defensin (Def2.1) gene, complete cds  89.7    7e-20
AY681967.1  Medicago sativa putative defensin 1.6 precursor (Def1...  88.2    1e-19
AY681970.1  Medicago sativa putative defensin 1.3 precursor (Def1...  88.2    1e-19
AY681969.1  Medicago sativa putative defensin 1.4 precursor (Def1...  88.2    1e-19
AY681968.1  Medicago sativa putative defensin 1.5 precursor (Def1...  87.0    2e-19
KF672189.1  Sophora chathamica microsatellite Sop-807 sequence        88.2    4e-19
L01579.1  Pisum sativum disease resistance response protein 39 (D...  84.0    7e-19
AY681973.1  Medicago sativa putative defensin 2.1 precursor (Def2...  82.8    5e-18
AF525685.1  Pisum sativum antimicrobial defensin peptide DRR230-c...  73.9    5e-16
XM_013597344.1  Medicago truncatula Nodule Cysteine-Rich (NCR) se...  70.9    2e-14
AB049718.1  Pisum sativum ssa-8 mRNA for putative senescence-asso...  64.3    2e-11
XM_006423263.1  Citrus clementina hypothetical protein (CICLE_v10...  63.9    6e-11
FJ948813.2  Nicotiana megalosiphon putative defensin mRNA, comple...  59.3    4e-10
XM_010322203.1  PREDICTED: Solanum lycopersicum defensin-like pro...  56.6    2e-08
XM_015199257.1  PREDICTED: Solanum pennellii defensin-like protei...  55.1    3e-08
XM_003630374.2  Medicago truncatula Defensin MtDef4.7 mRNA            55.1    8e-08
XM_006423264.1  Citrus clementina hypothetical protein (CICLE_v10...  53.5    1e-07
XM_010676850.1  PREDICTED: Beta vulgaris subsp. vulgaris defensin...  55.5    2e-07
XM_006495244.2  PREDICTED: Citrus sinensis defensin-like protein ...  53.9    5e-07
XM_006423265.1  Citrus clementina hypothetical protein (CICLE_v10...  53.5    6e-07
XM_015234300.1  PREDICTED: Solanum pennellii defensin-like protei...  50.8    1e-06
XR_685286.1  PREDICTED: Nicotiana tomentosiformis uncharacterized...  52.4    2e-06
XR_830953.1  PREDICTED: Elaeis guineensis uncharacterized LOC1050...  52.4    2e-06
XR_001658616.1  PREDICTED: Nicotiana tabacum uncharacterized LOC1...  50.8    6e-06
XM_012216514.1  PREDICTED: Jatropha curcas defensin-like protein ...  49.3    6e-06
XM_010676851.1  PREDICTED: Beta vulgaris subsp. vulgaris defensin...  51.2    7e-06
XM_014652387.1  PREDICTED: Vigna radiata var. radiata defensin Ec...  50.8    7e-06
XM_009760689.1  PREDICTED: Nicotiana sylvestris defensin-like pro...  49.3    8e-06
XR_741318.1  PREDICTED: Solanum lycopersicum defensin-like protei...  49.3    9e-06


>DQ288897.2 Cicer arietinum defensin (AFP-Ca) mRNA, complete cds
Length=225

 Score = 153 bits (387),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG
Sbjct  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  180

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCTKNC*
Sbjct  181  RCRDDFRCWCTKNC*  225


>XM_004487638.2 PREDICTED: Cicer arietinum defensin-like protein (LOC101512021), 
mRNA
Length=465

 Score = 152 bits (383),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            MDKKSLAGLCFLFLVLFVA+EIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG
Sbjct  77   MDKKSLAGLCFLFLVLFVAQEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  256

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCT+NC*
Sbjct  257  RCRDDFRCWCTRNC*  301


>AY907349.1 Tephrosia villosa defensin mRNA, complete cds
Length=228

 Score = 137 bits (345),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKSLAGLCFLFLVLFVA+E+ V SEA  CENLADTYRGPCFTTGSCDDHCKNKEHL+S
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEVVVQSEAKTCENLADTYRGPCFTTGSCDDHCKNKEHLLS  180

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCTK C*
Sbjct  181  GRCRDDFRCWCTKRC*  228


>BT090977.1 Soybean clone JCVI-FLGm-5F24 unknown mRNA
Length=513

 Score = 136 bits (342),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +3

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKS+AGLCFLFLVLFVA+E+ V +EA  CENLADTYRGPCFTTGSCDDHCKNKEHL+ 
Sbjct  69   MEKKSIAGLCFLFLVLFVAQEVVVQTEAKTCENLADTYRGPCFTTGSCDDHCKNKEHLLR  248

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCTKNC*
Sbjct  249  GRCRDDFRCWCTKNC*  296


>XM_003543198.3 PREDICTED: Glycine max defensin-like protein (LOC100779239), 
mRNA
Length=578

 Score = 136 bits (342),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKS+AGLCFLFLVLFVA+E+ V +EA  CENLADTYRGPCFTTGSCDDHCKNKEHL+ 
Sbjct  83   MEKKSIAGLCFLFLVLFVAQEVVVQTEAKTCENLADTYRGPCFTTGSCDDHCKNKEHLLR  262

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCTKNC*
Sbjct  263  GRCRDDFRCWCTKNC*  310


>X16877.1 Vigna unguiculata cDNA for stored cotyledon mRNA
Length=459

 Score = 134 bits (338),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKS+AGLCFLFLVLFVA+E+ V SEA  CENL DTYRGPCFTTGSCDDHCKNKEHL+S
Sbjct  14   MEKKSIAGLCFLFLVLFVAQEVVVQSEAKTCENLVDTYRGPCFTTGSCDDHCKNKEHLLS  193

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDD RCWCT+NC*
Sbjct  194  GRCRDDVRCWCTRNC*  241


>AB020613.1 Vigna radiata mRNA for PDF1, complete cds
Length=496

 Score = 135 bits (339),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKSLAGLCFLFLVLFVA+E+ V +EA  CENLA+TYRGPCFTTGSCDDHCKNKEHL S
Sbjct  46   MEKKSLAGLCFLFLVLFVAQEVMVQTEAKTCENLANTYRGPCFTTGSCDDHCKNKEHLRS  225

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCT+NC*
Sbjct  226  GRCRDDFRCWCTRNC*  273


>XM_014636686.1 PREDICTED: Vigna radiata var. radiata defensin-like protein (LOC106754639), 
mRNA
Length=510

 Score = 135 bits (339),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKSLAGLCFLFLVLFVA+E+ V +EA  CENLA+TYRGPCFTTGSCDDHCKNKEHL S
Sbjct  59   MEKKSLAGLCFLFLVLFVAQEVMVQTEAKTCENLANTYRGPCFTTGSCDDHCKNKEHLRS  238

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCT+NC*
Sbjct  239  GRCRDDFRCWCTRNC*  286


>HM240258.1 Phaseolus vulgaris cultivar BAT93 defensin D1 mRNA, complete 
cds
Length=537

 Score = 135 bits (339),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKSLAGLCFLFLVLFVA+E+ + +EA  CENLADTY+GPCFTTGSCDDHCKNKEHL S
Sbjct  50   MEKKSLAGLCFLFLVLFVAQEVVLQTEAKTCENLADTYKGPCFTTGSCDDHCKNKEHLRS  229

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCTKNC*
Sbjct  230  GRCRDDFRCWCTKNC*  277


>JQ314214.1 Psophocarpus tetragonolobus defensin mRNA, complete cds
Length=228

 Score = 130 bits (328),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            MDKKSLAGLCFLFLVLFVA+E+ V +EA  CENLADT+RGPCF T +CDDHCKNKEHL+ 
Sbjct  1    MDKKSLAGLCFLFLVLFVAQEVVVQTEAKTCENLADTFRGPCFATANCDDHCKNKEHLLR  180

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDD+RCWCTKNC*
Sbjct  181  GRCRDDYRCWCTKNC*  228


>XM_007149386.1 Phaseolus vulgaris hypothetical protein (PHAVU_005G071300g) mRNA, 
complete cds
Length=560

 Score = 134 bits (336),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKSLAGLCFLFLVLFV +E+ + +EA  CENLADTY+GPCFTTGSCDDHCKNKEHL S
Sbjct  73   MEKKSLAGLCFLFLVLFVTQEVVLQTEAKTCENLADTYKGPCFTTGSCDDHCKNKEHLRS  252

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCTKNC*
Sbjct  253  GRCRDDFRCWCTKNC*  300


>XM_017568810.1 PREDICTED: Vigna angularis defensin-like protein (LOC108333379), 
mRNA
Length=527

 Score = 132 bits (333),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAAR-CENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKSLAGLCFLFLVLFVA+E+ V   AR CENLA++YRGPC TTGSCDDHCKNKEHL S
Sbjct  73   MEKKSLAGLCFLFLVLFVAQEVVVQTEARTCENLANSYRGPCITTGSCDDHCKNKEHLNS  252

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCTKNC*
Sbjct  253  GRCRDDFRCWCTKNC*  300


>LN913082.1 Vigna radiata mRNA for defensin protein (PDF1 gene), cultivar 
Dautam
Length=228

 Score = 129 bits (324),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKS  GLCFLFLVLFVA+E+ V +EA  CENLA+TYRGPCF TGSCDDHCKNKEHL S
Sbjct  1    MEKKSWPGLCFLFLVLFVAQEVMVQTEAKTCENLANTYRGPCFPTGSCDDHCKNKEHLRS  180

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCT+NC*
Sbjct  181  GRCRDDFRCWCTRNC*  228


>LN901492.1 Vigna radiata PDF1 gene for defensin protein, cultivar Dautam
Length=228

 Score = 129 bits (324),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKS  GLCFLFLVLFVA+E+ V +EA  CENLA+TYRGPCF TGSCDDHCKNKEHL S
Sbjct  1    MEKKSWPGLCFLFLVLFVAQEVMVQTEAKTCENLANTYRGPCFPTGSCDDHCKNKEHLRS  180

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCT+NC*
Sbjct  181  GRCRDDFRCWCTRNC*  228


>JX424594.1 Arachis hypogaea low molecular weight cysteine-rich protein 68 
mRNA, complete cds
Length=228

 Score = 127 bits (320),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M  KSL G CF+ L+L VA+E+ V SEAA CENLADTYRGPCFTTGSCDDHCKNKEHL+S
Sbjct  1    MAGKSLTGFCFILLLLVVAQEMVVQSEAATCENLADTYRGPCFTTGSCDDHCKNKEHLLS  180

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCT+NC*
Sbjct  181  GRCRDDFRCWCTRNC*  228


>JQ314215.1 Clitoria ternatea defensin mRNA, complete cds
Length=228

 Score = 127 bits (320),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            MDKKSLAGLCFLFLVLFVA+E+ V +EA  CENLAD +RG C  TG+CDDHCKNKEHLVS
Sbjct  1    MDKKSLAGLCFLFLVLFVAQEVVVQTEAKTCENLADAFRGLCIATGNCDDHCKNKEHLVS  180

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDD RCWCTKNC*
Sbjct  181  GRCRDDLRCWCTKNC*  228


>DQ296045.1 Arachis hypogaea disease resistance response protein mRNA, partial 
cds
Length=225

 Score = 127 bits (319),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M  KSL G CF+ L+L VA+E+ V SEAA CENLADTYRGPCFTTGSCDDHCKNKEHL+S
Sbjct  1    MAGKSLTGFCFILLLLVVAQEMVVQSEAATCENLADTYRGPCFTTGSCDDHCKNKEHLLS  180

Query  60   GRCRDDFRCWCTKNC  74
            GRCRDDFRCWCT+NC
Sbjct  181  GRCRDDFRCWCTRNC  225


>XM_016081261.1 PREDICTED: Arachis duranensis defensin-like protein (LOC107462635), 
mRNA
Length=545

 Score = 127 bits (320),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M  KSL G CF+ L+L VA+E+ V SEAA CENLADTYRGPCFTTGSCDDHCKNKEHL+S
Sbjct  73   MAGKSLTGFCFILLLLVVAQEMVVQSEAATCENLADTYRGPCFTTGSCDDHCKNKEHLLS  252

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCT+NC*
Sbjct  253  GRCRDDFRCWCTRNC*  300


>XM_016316566.1 PREDICTED: Arachis ipaensis defensin-like protein (LOC107614352), 
mRNA
Length=569

 Score = 127 bits (320),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M  KSL G CF+ L+L VA+E+ V SEAA CENLADTYRGPCFTTGSCDDHCKNKEHL+S
Sbjct  80   MAGKSLTGFCFILLLLVVAQEMVVQSEAATCENLADTYRGPCFTTGSCDDHCKNKEHLLS  259

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCT+NC*
Sbjct  260  GRCRDDFRCWCTRNC*  307


>XM_007149387.1 Phaseolus vulgaris hypothetical protein (PHAVU_005G071400g) mRNA, 
complete cds
Length=503

 Score = 126 bits (317),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEE-IAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKS AGLCFLFLVLFVA+E +  +EA  CENLADT+RGPCF TG+CDDHCKNKEHL+ 
Sbjct  38   MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLR  217

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCT+NC*
Sbjct  218  GRCRDDFRCWCTRNC*  265


>LN913083.1 Vigna radiata mRNA for defensin protein (PDF1 gene), cultivar 
DX22
Length=228

 Score = 123 bits (309),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKSLAGLCFLFLVLFVA+E+ V +E   CE LA+TYRGPCFTT SCDDHC+ KEH+ S
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEVMVQTEVKTCEKLANTYRGPCFTTDSCDDHCEIKEHMRS  180

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCT+NC*
Sbjct  181  GRCRDDFRCWCTRNC*  228


>LN901493.1 Vigna radiata PDF1 gene for defensin protein, cultivar DX22
Length=228

 Score = 123 bits (309),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KKSLAGLCFLFLVLFVA+E+ V +E   CE LA+TYRGPCFTT SCDDHC+ KEH+ S
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEVMVQTEVKTCEKLANTYRGPCFTTDSCDDHCEIKEHMRS  180

Query  60   GRCRDDFRCWCTKNC*  75
            GRCRDDFRCWCT+NC*
Sbjct  181  GRCRDDFRCWCTRNC*  228


>EU920046.1 Vicia faba clone 016 E08 defensin-like protein mRNA, complete 
cds
Length=225

 Score = 122 bits (305),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KK++A L FLFLVLFVA+EIAVSEA  CENL+DT++GPC   G+C+ HCKN EHL+SG
Sbjct  1    MEKKAVAALSFLFLVLFVAQEIAVSEAKTCENLSDTFKGPCIPDGNCNKHCKNNEHLLSG  180

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCT+NC*
Sbjct  181  RCRDDFRCWCTRNC*  225


>EU920045.1 Vicia faba clone 011 F07 defensin-like protein mRNA, complete 
cds
Length=225

 Score = 122 bits (305),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KK++A L FLFLVLFVA+EIAVSEA  CENL+DT++GPC   G+C+ HCKN EHL+SG
Sbjct  1    MEKKAVAALSFLFLVLFVAQEIAVSEAKTCENLSDTFKGPCIPDGNCNKHCKNNEHLLSG  180

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCT+NC*
Sbjct  181  RCRDDFRCWCTRNC*  225


>AY288448.1 Arachis diogoi defensin mRNA, complete cds
 AY182163.1 Trigonella foenum-graecum antifungal protein defensin mRNA, complete 
cds
Length=225

 Score = 121 bits (304),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KKSLA L FLFLVLFV +EI V+EAA CENLADT+RGPCF   +C+ HCK KEHL+SG
Sbjct  1    MEKKSLAALSFLFLVLFVTQEIVVTEAATCENLADTFRGPCFGNSNCNFHCKTKEHLLSG  180

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCTK C*
Sbjct  181  RCRDDFRCWCTKRC*  225


>AY182164.1 Arachis diogoi antifungal protein defensin mRNA, complete cds
 AY206395.1 Cicer arietinum defensin mRNA, complete cds
Length=219

 Score = 120 bits (302),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KKSLAGLCFLFLVLFVA+EI V+EA  CENLAD YRGPCF+   CD HC  KEH VSG
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKEHAVSG  174

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCTK C*
Sbjct  175  RCRDDFRCWCTKRC*  219


>AY227192.1 Trigonella foenum-graecum defensin mRNA, complete cds
 AY244556.1 Cajanus cajan defensin mRNA, complete cds
Length=219

 Score = 120 bits (302),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KKSLAGLCFLFLVLFVA+EI V+EA  CENLAD YRGPCF+   CD HC  KEH VSG
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKEHAVSG  174

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCTK C*
Sbjct  175  RCRDDFRCWCTKRC*  219


>KF498667.1 Synthetic construct defensin 2/antifungal protein 2 fusion protein 
gene, complete cds
Length=495

 Score = 122 bits (307),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KKSLAGLCFLFLVLFVA+EI V+EA  CENLAD YRGPCF+   CD HC  KEH VSG
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKEHAVSG  174

Query  61   RCRDDFRCWCTKNC  74
            RCRDDFRCWCTK C
Sbjct  175  RCRDDFRCWCTKRC  216


>AY681971.1 Medicago sativa putative defensin 1.2 precursor (Def1.2) gene, 
complete cds
Length=219

 Score = 118 bits (295),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KKSLAGLCFLFLVLFVA+EI V+EA  CENLAD YRGPCF+   CD HC  KE+ VSG
Sbjct  1    MEKKSLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKENAVSG  174

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCTK C*
Sbjct  175  RCRDDFRCWCTKRC*  219


>XM_013609260.1 Medicago truncatula Defensin MtDef1.1/MtDef1.2 mRNA
Length=428

 Score = 119 bits (299),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KK+LAGLCFLFLVLFVA+EI V+EA  CENLAD YRGPCF+   CD HC  KE+ VSG
Sbjct  43   MEKKTLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKENAVSG  216

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCTKNC*
Sbjct  217  RCRDDFRCWCTKNC*  261


>EF194158.1 Lens culinaris subsp. culinaris defensin precursor, mRNA, complete 
cds
Length=455

 Score = 118 bits (296),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KK++A L FLF+VLFVA+EIAV+EA  CENL+D+++GPC   G+C+ HCK KEHL+SG
Sbjct  31   MEKKTVAALSFLFIVLFVAQEIAVTEAKTCENLSDSFKGPCIPDGNCNKHCKEKEHLLSG  210

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCT+NC*
Sbjct  211  RCRDDFRCWCTRNC*  255


>AF319468.1 Medicago sativa antifungal protein precursor, mRNA, complete 
cds
Length=406

 Score = 117 bits (294),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 2/75 (3%)
 Frame = +3

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KKSLAGLCFLFLVLFVA+EI V+EA  CENLAD YRGPCF+   CD HC  KE+ VSG
Sbjct  75   MEKKSLAGLCFLFLVLFVAQEIVVTEARTCENLADKYRGPCFS--GCDTHCTTKENAVSG  248

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCTK C*
Sbjct  249  RCRDDFRCWCTKRC*  293


>DQ342338.1 Cicer arietinum defensin (AFP) gene, promoter region and complete 
cds
Length=1050

 Score = 120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 7/72 (10%)
 Frame = +1

Query  11    FLFLVLFV-------AEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCR  63
             F++++ ++       AEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCR
Sbjct  835   FVYIMKYIFK*YYIYAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCR  1014

Query  64    DDFRCWCTKNC*  75
             DDFRCWCTKNC*
Sbjct  1015  DDFRCWCTKNC*  1050


>EU920048.1 Vicia faba clone 042 D02 defensin-like protein mRNA, complete 
cds
Length=222

 Score = 111 bits (278),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KKS+A L FLFLVLFVA+EI V+EA  CE+LADTYRGPC T  SCDDHCKNK HL+SG
Sbjct  1    MEKKSVAALSFLFLVLFVAQEIVVTEARTCEHLADTYRGPCLTNASCDDHCKNKAHLISG  180

Query  61   RCRDDFRCWCTKNC*  75
             C  +++C+CT+NC*
Sbjct  181  TCH-NYKCFCTQNC*  222


>EU920047.1 Vicia faba clone 039 F05 defensin-like protein mRNA, complete 
cds
Length=222

 Score = 109 bits (273),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KK++A L FLFLVLFVA+EI V+EA  CE+LADTYRGPC T  SCDDHCKNK HL+SG
Sbjct  1    MEKKAVAALSFLFLVLFVAQEIVVTEARTCEHLADTYRGPCLTDASCDDHCKNKAHLISG  180

Query  61   RCRDDFRCWCTKNC*  75
             C  +++C+CT+NC*
Sbjct  181  TCH-NYKCFCTQNC*  222


>EU920044.1 Vicia faba clone 004 C04 defensin-like protein mRNA, complete 
cds
Length=222

 Score = 109 bits (273),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KK++A L FLFLVLFVA+EI V+EA  CE+LADTYRGPC T  SCDDHCKNK HL+SG
Sbjct  1    MEKKAVAALSFLFLVLFVAQEIVVTEARTCEHLADTYRGPCLTDASCDDHCKNKAHLISG  180

Query  61   RCRDDFRCWCTKNC*  75
             C  +++C+CT+NC*
Sbjct  181  TCH-NYKCFCTQNC*  222


>AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete 
sequence, cultivar: Shumari
Length=33495452

 Score = 116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 69/110 (63%), Gaps = 35/110 (32%)
 Frame = -1

Query  1         MDKKSLAGLCFLFLVLFVA----------------------------------EEIAVSE  26
                 M+KKSLAGLCFLFLVLFVA                                  EE+ V  
Sbjct  14041556  MEKKSLAGLCFLFLVLFVARKSLLLCSFFRMILYL*W*ILYNRMSLTYVFEQAEEVVVQT  14041377

Query  27        AAR-CENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC*  75
                  AR CENLA++YRGPC TTGSCDDHCKNKEHL SGRCRDDFRCWCTKNC*
Sbjct  14041376  EARTCENLANSYRGPCITTGSCDDHCKNKEHLNSGRCRDDFRCWCTKNC*  14041227


>JX424606.1 Arachis hypogaea low molecular weight cysteine-rich protein 68 
gene, complete cds
Length=687

 Score = 110 bits (275),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  13   FLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTK  72
             +++ V E +  SEAA CENLADTYRGPCFTTGSCDDHCKNKEHL+SGRCRDDFRCWCT+
Sbjct  499  LMLVRVEEMVVQSEAATCENLADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDFRCWCTR  678

Query  73   NC*  75
            NC*
Sbjct  679  NC*  687


>FJ174689.1 Pisum sativum pathogenesis-related protein mRNA, complete cds
Length=515

 Score = 107 bits (268),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +3

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KK++A L FLFLVLFVA+EI V+EA  CE+LADTYRG CFT  SCDDHCKNK HL+SG
Sbjct  63   MEKKAVAALSFLFLVLFVAQEIVVTEAKTCEHLADTYRGVCFTNASCDDHCKNKAHLISG  242

Query  61   RCRDDFRCWCTKNC*  75
             C  +++C+CT+NC*
Sbjct  243  TCH-NWKCFCTQNC*  284


>AF139018.1 Pisum sativum disease resistance response protein 230 precursor 
(DRR230) mRNA, complete cds
Length=363

 Score = 106 bits (264),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KKSLA L FL LVLF+A+EI VSEA  CENLA +Y+G CF  G CD HC+ +E  +SG
Sbjct  56   MEKKSLACLSFLLLVLFIAQEIVVSEANTCENLAGSYKGVCF--GGCDRHCRTQEGAISG  229

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCTKNC*
Sbjct  230  RCRDDFRCWCTKNC*  274


>AY560901.1 Medicago truncatula putative defensin 3.1 (Def3.1) gene, complete 
cds
Length=318

 Score = 103 bits (257),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 64/108 (59%), Gaps = 35/108 (32%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVA---------------------------------EEIAVSEA  27
            M+KKSLAGLCFLFLVLFVA                                 EEI V+EA
Sbjct  1    MEKKSLAGLCFLFLVLFVARN*VHHSYH*SYSAFVISSYILYFNIIVMFINAEEIVVTEA  180

Query  28   ARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC*  75
              CENLAD YRGPCF+   CD HC  KE+ VSGRCRDDFRCWCT+NC*
Sbjct  181  KTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCTRNC*  318


>KJ939334.1 Phaseolus vulgaris cultivar polesta defensin (pdf) gene, complete 
cds
Length=486

 Score = 105 bits (261),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 2/67 (3%)
 Frame = +1

Query  11   FLFLVLFVAEE--IAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRC  68
            ++ + LF   E  +  +EA  CENLADTYRGPCFTTGSCDDHCKNKEHL+SGRCRDDFRC
Sbjct  286  YMLMNLFEHAEECVLQTEAKTCENLADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDFRC  465

Query  69   WCTKNC*  75
            WCTKNC*
Sbjct  466  WCTKNC*  486


>AY313166.1 Medicago truncatula defensin (Def1) gene, complete cds
 AY681972.1 Medicago sativa putative defensin 1.1 precursor (Def1.1) gene, 
complete cds
Length=318

 Score = 102 bits (254),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 63/108 (58%), Gaps = 35/108 (32%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVA---------------------------------EEIAVSEA  27
            M+KKSLAGLCFLFLVLFVA                                 EEI V+EA
Sbjct  1    MEKKSLAGLCFLFLVLFVARN*VHHSYH*SYSAFVISSYILYFNIIVMFINAEEIVVTEA  180

Query  28   ARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC*  75
              CENLAD YRGPCF+   CD HC  KE+ VSGRCRDDFRCWCTK C*
Sbjct  181  KTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCTKRC*  318


>AY560900.1 Medicago sativa putative defensin 3.2 (Def3.2) gene, complete 
cds
Length=1004

 Score = 107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  12    LFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCT  71
             + ++   AEEI V+EA  CENLADT+RGPCFT G+CDDHCKNKEHLVSGRCRDDFRCWCT
Sbjct  813   MSML*IYAEEIVVTEAKTCENLADTFRGPCFTNGACDDHCKNKEHLVSGRCRDDFRCWCT  992

Query  72    KNC*  75
             +NC*
Sbjct  993   RNC*  1004


>LN901494.1 Vigna radiata PDF1 gene intron, cultivar Dautam
Length=356

 Score = 100 bits (249),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 57/69 (83%), Gaps = 2/69 (3%)
 Frame = +3

Query  9    LCFLFLVLFV-AEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDF  66
            L  + + LF  AEE+ V +EA  CENLA+TYRGPCF TGSCDDHCKNKEHL SGRCRDDF
Sbjct  150  L*HMRISLFEHAEEVMVQTEAKTCENLANTYRGPCFPTGSCDDHCKNKEHLRSGRCRDDF  329

Query  67   RCWCTKNC*  75
            RCWCT+NC*
Sbjct  330  RCWCTRNC*  356


>AY560899.1 Medicago sativa putative defensin 3.1 (Def3.1) gene, complete 
cds
Length=495

 Score = 100 bits (248),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +1

Query  4    KSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCR  63
            K L  + +L+  L  AEEI V+EAA CENLA+TYRGPCF  G CD HCK KEHL+SGRCR
Sbjct  286  KHLCIIQYLYCYLVDAEEIMVTEAATCENLANTYRGPCF--GGCDFHCKTKEHLLSGRCR  459

Query  64   DDFRCWCTKNC*  75
            DDFRCWCT+NC*
Sbjct  460  DDFRCWCTRNC*  495


>XM_016081189.1 PREDICTED: Arachis duranensis defensin-1-like (LOC107462579), 
mRNA
Length=477

 Score = 98.6 bits (244),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +3

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KK++AG C  FLVLF+A+E  V +EA  C +LADTYRGPCFT  SCDDHCKNKEH VS
Sbjct  243  MEKKTVAGFCIFFLVLFLAQEGVVKTEAKLCNHLADTYRGPCFTNASCDDHCKNKEHFVS  422

Query  60   GRCRDDFRCWCTKNC*  75
            G C     CWC  NC*
Sbjct  423  GTCM-KMACWCAHNC*  467


>XM_013609259.1 Medicago truncatula Defensin MtDef2.1 mRNA
Length=463

 Score = 98.2 bits (243),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KKS+AGLC LFLVLFVA+EIAV+EA  CE+LADTYRGPCFT GSCDDHCKNK HL+SG
Sbjct  59   MEKKSIAGLCLLFLVLFVAQEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISG  238

Query  61   RCRDDFRCWCTKNC*  75
             C  +F+C+CT+NC*
Sbjct  239  TCH-NFQCFCTQNC*  280


>FJ380052.1 Vigna unguiculata defensin mRNA, partial cds
Length=144

 Score = 94.4 bits (233),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +1

Query  30   CENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC*  75
            CENLADTYRGPCFTTGSCDDHCKNKEHL+SGRCRDD RCWCT+NC*
Sbjct  7    CENLADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDVRCWCTRNC*  144


>XR_001614224.1 PREDICTED: Arachis ipaensis uncharacterized LOC107613898 (LOC107613898), 
ncRNA
Length=652

 Score = 98.6 bits (244),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAV-SEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVS  59
            M+KK++AG C  FLVLF+A+E  V +EA  C +LADTYRGPCFT  SCDDHCKNKEH VS
Sbjct  254  MEKKTVAGFCIFFLVLFLAQEGVVKTEAKLCNHLADTYRGPCFTNASCDDHCKNKEHFVS  433

Query  60   GRCRDDFRCWCTKNC*  75
            G C     CWC  NC*
Sbjct  434  GTCM-KMACWCAHNC*  478


>AY679170.1 Pachyrhizus erosus defensin (spe10) mRNA, partial cds
Length=141

 Score = 91.3 bits (225),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  30   CENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC  74
            CENLADT+RGPCFT GSCDDHCKNKEHL+ GRCRDDFRCWCT+NC
Sbjct  7    CENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC  141


>LN901495.1 Vigna radiata PDF1 gene intron, cultivar DX22
Length=356

 Score = 90.5 bits (223),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +3

Query  12   LFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCT  71
            + L+    E +  +E   CE LA+TYRGPCFTT SCDDHC+ KEH+ SGRCRDDFRCWCT
Sbjct  165  MSLLEHAKEVMVQTEVKTCEKLANTYRGPCFTTDSCDDHCEIKEHMRSGRCRDDFRCWCT  344

Query  72   KNC*  75
            +NC*
Sbjct  345  RNC*  356


>AY571902.1 Medicago truncatula cultivar Jemalong Def3.1 (Def3.1) gene, partial 
cds
Length=2053

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  12    LFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCT  71
             + +V   AEEI V+EA  CENLA T+RGPCF   +CD HC+ KEHLVSGRCRDDFRCWCT
Sbjct  1398  VVIVYLDAEEIVVTEANTCENLAGTFRGPCFGNSNCDFHCRTKEHLVSGRCRDDFRCWCT  1577

Query  72    KNC*  75
             +NC*
Sbjct  1578  RNC*  1589


>AF535089.1 Trigonella foenum-graecum defensin gene, complete cds
Length=701

 Score = 91.3 bits (225),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +3

Query  13   FLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTK  72
             +V+  AEEI V+EA  CENLAD YRGPCF+   CD HC  KEH VSGRCRDDFRCWCTK
Sbjct  519  IVVMVHAEEIVVTEAKTCENLADKYRGPCFS--GCDTHCTTKEHAVSGRCRDDFRCWCTK  692

Query  73   NC*  75
             C*
Sbjct  693  RC*  701


>XR_001614223.1 PREDICTED: Arachis ipaensis uncharacterized LOC107613897 (LOC107613897), 
ncRNA
Length=614

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  3    KKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRC  62
            +K +AG C  FL+LF+A+E  V E   C NL+D ++GPC  + +CD HC++ EHL+SG C
Sbjct  143  EKKMAGFCIFFLILFLAQEYGV-EGKECLNLSDKFKGPCLGSKNCDHHCRDIEHLLSGVC  319

Query  63   RDDFRCWCTKNC*  75
            RDDFRCWC + C*
Sbjct  320  RDDFRCWCNRKC*  358


>L01578.1 Pea (pi230) disease resistance response protein 230 (DRR230-a) 
mRNA, complete cds
 X52225.1 P.sativum pI230 mRNA
Length=468

 Score = 87.4 bits (215),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = +3

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M+KKSLA L FL LVLFVA+EI VSEA  CENLA +Y+G CF  G CD HC+ +E  +SG
Sbjct  78   MEKKSLACLSFLLLVLFVAQEIVVSEANTCENLAGSYKGVCF--GGCDRHCRTQEGAISG  251

Query  61   RCRDDFRCWCTKNC*  75
            RCRDDFRCWCTKNC*
Sbjct  252  RCRDDFRCWCTKNC*  296


>AY313169.1 Medicago truncatula defensin (Def2.1) gene, complete cds
Length=876

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = +1

Query  19   AEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC*  75
            AEEIAV+EA  CE+LADTYRGPCFT GSCDDHCKNK HL+SG C  +F+C+CT+NC*
Sbjct  709  AEEIAVTEARTCEHLADTYRGPCFTEGSCDDHCKNKAHLISGTCH-NFQCFCTQNC*  876


>AY681967.1 Medicago sativa putative defensin 1.6 precursor (Def1.6) gene, 
complete cds
Length=745

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +2

Query  13   FLVLFV-AEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCT  71
             +V+F+ AEEI V+EA  CENLAD YRGPCF+   CD HC  KE+ VSGRCRDDFRCWCT
Sbjct  560  IVVIFINAEEIVVTEARTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCT  733

Query  72   KNC*  75
            K C*
Sbjct  734  KRC*  745


>AY681970.1 Medicago sativa putative defensin 1.3 precursor (Def1.3) gene, 
complete cds
Length=786

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +1

Query  13   FLVLFV-AEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCT  71
             +V+F+ AEEI V+EA  CENLAD YRGPCF+   CD HC  KE+ VSGRCRDDFRCWCT
Sbjct  601  IVVMFINAEEIVVTEARTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCT  774

Query  72   KNC*  75
            K C*
Sbjct  775  KRC*  786


>AY681969.1 Medicago sativa putative defensin 1.4 precursor (Def1.4) gene, 
complete cds
Length=793

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +2

Query  13   FLVLFV-AEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCT  71
             +V+F+ AEEI V+EA  CENLAD YRGPCF+   CD HC  KE+ VSGRCRDDFRCWCT
Sbjct  608  IVVMFINAEEIVVTEARTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCT  781

Query  72   KNC*  75
            K C*
Sbjct  782  KRC*  793


>AY681968.1 Medicago sativa putative defensin 1.5 precursor (Def1.5) gene, 
complete cds
Length=679

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = +2

Query  13   FLVLFV-AEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCT  71
             +V+F+ AEEI V EA  CENLAD YRGPCF+   CD HC  KE+ VSGRCRDDFRCWCT
Sbjct  494  IVVIFINAEEIVVIEARTCENLADKYRGPCFS--GCDTHCTTKENAVSGRCRDDFRCWCT  667

Query  72   KNC*  75
            K C*
Sbjct  668  KRC*  679


>KF672189.1 Sophora chathamica microsatellite Sop-807 sequence
Length=1027

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +1

Query  34   ADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC*  75
            ADTYRGPCFTTGSCDDHCKNKEHL+SGRCRDDFRCWCT+NC*
Sbjct  742  ADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDFRCWCTRNC*  867


>L01579.1 Pisum sativum disease resistance response protein 39 (DRR230-b) 
mRNA, complete cds
 X52224.1 P.sativum pI39 mRNA
Length=456

 Score = 84.0 bits (206),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +3

Query  19   AEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC*  75
            A+EI V+EA  CE+LADTYRG CFT  SCDDHCKNK HL+SG C  D++C+CT+NC*
Sbjct  126  AQEIVVTEANTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCH-DWKCFCTQNC*  293


>AY681973.1 Medicago sativa putative defensin 2.1 precursor (Def2.1) gene, 
complete cds
Length=564

 Score = 82.8 bits (203),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +1

Query  19   AEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC*  75
            AEEI V+EA  CE+LADTYRGPCFT  SCDDHCKNK HL+SG C    +C+CT+NC*
Sbjct  397  AEEIVVTEARTCEHLADTYRGPCFTDASCDDHCKNKAHLISGTCH-RLQCFCTQNC*  564


>AF525685.1 Pisum sativum antimicrobial defensin peptide DRR230-c (DRR230-c) 
mRNA, partial cds
Length=180

 Score = 73.9 bits (180),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  18   VAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFRC  68
            VA+EI V+EA  CE+LADTYRG CFT  SCDDHCKNK HL+SG C  +F+C
Sbjct  31   VAQEIVVTEANTCEHLADTYRGVCFTDASCDDHCKNKAHLISGTCH-NFKC  180


>XM_013597344.1 Medicago truncatula Nodule Cysteine-Rich (NCR) secreted peptide 
partial mRNA
Length=258

 Score = 70.9 bits (172),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 47/86 (55%), Gaps = 11/86 (13%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLAD--------TYRG---PCFTTGSCDD  49
            M+KKSLA LCFLFLV FV ++  V E    E L+D        T+ G   P F    CD 
Sbjct  1    MEKKSLAELCFLFLVFFVTKKNVVIETRASEVLSDGVCMSLSGTFNGLCIPPFMNNRCDK  180

Query  50   HCKNKEHLVSGRCRDDFRCWCTKNC*  75
             CKNKEH   G+C  D RCWC   C*
Sbjct  181  SCKNKEHKYYGKCWQDLRCWCYGEC*  258


>AB049718.1 Pisum sativum ssa-8 mRNA for putative senescence-associated protein, 
complete cds
Length=380

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  39   GPCFTTGSCDDHCKNKEHLVSGRCRDDFRCWCTKNC*  75
            GPC   G+C+ HC+N EH++SGRCRDDFRCWCT+NC*
Sbjct  356  GPCIPDGNCNKHCRNNEHILSGRCRDDFRCWCTRNC*  246


>XM_006423263.1 Citrus clementina hypothetical protein (CICLE_v10029711mg) mRNA, 
complete cds
Length=512

 Score = 63.9 bits (154),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 3/71 (4%)
 Frame = +2

Query  8    GLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDFR  67
             L F F +LF + E+ V+EA +C   A  + GPC  TGSC +HC+ +E  V G C  DF 
Sbjct  47   ALIFAFFILFASFEMPVAEAKQCSKRAQKWTGPCIKTGSCRNHCRKREGAVDGACHYDFP  226

Query  68   ---CWCTKNC*  75
               C+C  NC*
Sbjct  227  GFACFCYYNC*  259


>FJ948813.2 Nicotiana megalosiphon putative defensin mRNA, complete cds
Length=219

 Score = 59.3 bits (142),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            MD+ +L  LCF++LVLFVA+EI V+EA  C+  A    G CF   +C   C+ +     G
Sbjct  1    MDRVALVSLCFVYLVLFVAQEIVVTEARECK--AQGRHGTCFRDANCVQVCEKQAGWSHG  174

Query  61   RCRDDFRCWCTKNC*  75
             CR  F+C C   C*
Sbjct  175  DCRAQFKCKCIFEC*  219


>XM_010322203.1 PREDICTED: Solanum lycopersicum defensin-like protein 1 (LOC104647220), 
transcript variant X1, mRNA
Length=367

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLF---VAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHL  57
            M K       FL L+LF    + EI  +E+  CE ++ T+ GPCF TG C++ C N EH 
Sbjct  2    MAKSQFHYAAFLALILFFVIASNEIQKAESIGCEKMSVTWSGPCFDTGGCNNQCINWEHA  181

Query  58   VSGRCRDDF  66
            + G C  D+
Sbjct  182  IHGACHWDW  208


>XM_015199257.1 PREDICTED: Solanum pennellii defensin-like protein 1 (LOC107001067), 
mRNA
Length=240

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLF---VAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHL  57
            M K       FL L+LF    + +I  +E+  CE ++ T+ GPCF TG C++ C N EH 
Sbjct  1    MAKPQFHYAAFLALILFFLIASNDIQKAESIGCEKMSVTWSGPCFDTGGCNNQCINWEHA  180

Query  58   VSGRCRDDF  66
            + G C  D+
Sbjct  181  IHGACHWDW  207


>XM_003630374.2 Medicago truncatula Defensin MtDef4.7 mRNA
Length=409

 Score = 55.1 bits (131),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M++K+L  L  LFLVL     +  +E  RCE+ +  ++GPC +  +C   C+  E  + G
Sbjct  28   MERKTLGILFMLFLVLAADVAVKTAEGRRCESQSHKFKGPCVSDSNCGSVCRG-EGFIGG  204

Query  61   RCRD-DFRCWCTKNC*  75
             CR    RC+CT+NC*
Sbjct  205  DCRGVRHRCFCTRNC*  252


>XM_006423264.1 Citrus clementina hypothetical protein (CICLE_v10029828mg) mRNA, 
complete cds
Length=249

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
 Frame = +1

Query  8    GLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDD--  65
             L F F +LF +  + ++EA  C+  + T+ GPC  TG C   CK +E+   G C     
Sbjct  37   ALIFAFFILFASFGVPMAEAKVCQRRSKTWSGPCLNTGKCSRQCKQQEYARYGACYRQGA  216

Query  66   -FRCWCTKNC*  75
             + C+C  NC*
Sbjct  217  GYACYCYFNC*  249


>XM_010676850.1 PREDICTED: Beta vulgaris subsp. vulgaris defensin-like protein 
1 (LOC104891192), transcript variant X1, mRNA
Length=610

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +3

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            MD++ L GLC LFLVLF + E+  +E   C++ +  ++GPC    +C   C+N E    G
Sbjct  96   MDRR-LFGLCILFLVLFASPEVKQAEGRVCQSRSHYFKGPCARDHNCAYVCRN-EGFSGG  269

Query  61   RCRDDF-RCWCTKNC*  75
            RC   F RC+CT+ C*
Sbjct  270  RCHGFFRRCYCTRLC*  317


>XM_006495244.2 PREDICTED: Citrus sinensis defensin-like protein 1 (LOC102607346), 
mRNA
Length=552

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
 Frame = +1

Query  8    GLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDD--  65
             L F F +LF + E+ ++EA  C+  + T+ GPC  TG C  HCK +E    G C     
Sbjct  79   ALIFAFFILFASFEVPMAEAKVCQRRSKTWSGPCLNTGKCSRHCKQQEDARYGACYRQGT  258

Query  66   -FRCWCTKNC*  75
             + C+C   C*
Sbjct  259  GYACFCYFEC*  291


>XM_006423265.1 Citrus clementina hypothetical protein (CICLE_v10029712mg) mRNA, 
complete cds
Length=529

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
 Frame = +1

Query  8    GLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDD--  65
             L F F +LF +  + ++EA  C+  + T+ GPC  TG C   CK +E+   G C     
Sbjct  52   ALIFAFFILFASFGVPMAEAKVCQRRSKTWSGPCLNTGKCSRQCKQQEYARYGACYRQGA  231

Query  66   -FRCWCTKNC*  75
             + C+C  NC*
Sbjct  232  GYACYCYFNC*  264


>XM_015234300.1 PREDICTED: Solanum pennellii defensin-like protein 1 (LOC107032726), 
mRNA
Length=240

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLF---VAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHL  57
            M K       FL L +F    + +I  +E+  CE ++ T+ GPCF TG C++ C + EH 
Sbjct  1    MAKSQFQYAAFLALFVFFLVASNDIQKAESIGCEKMSVTWSGPCFDTGGCNNQCIDWEHA  180

Query  58   VSGRCRDDF  66
            + G C  D+
Sbjct  181  IHGACHWDW  207


>XR_685286.1 PREDICTED: Nicotiana tomentosiformis uncharacterized LOC104091810 
(LOC104091810), ncRNA
Length=526

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +1

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M  K    + F FL L V+ E+   EA  C+  + T+ GPC  TG+C   CKN+E    G
Sbjct  76   MSNKVFLAILFCFL-LIVSNEMQGGEAKVCQRRSKTWSGPCINTGNCSRQCKNQEDARFG  252

Query  61   RC---RDDFRCWCTKNC*  75
             C   R  F C+C  NC*
Sbjct  253  ACHRSRIGFACFCYFNC*  306


>XR_830953.1 PREDICTED: Elaeis guineensis uncharacterized LOC105039686 (LOC105039686), 
ncRNA
Length=538

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +1

Query  7    AGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNK-EHLVSGRCRDD  65
             GL FL L+LF +E + ++ A  CE+ + TYRG C    +C   C+ +      GRCR  
Sbjct  82   TGLVFLLLILFTSEMMTIASARLCESQSHTYRGTCTNNHNCAIVCQREGRGFTGGRCRGF  261

Query  66   F-RCWCTKNC*  75
            + RC+CTK C*
Sbjct  262  WRRCYCTKIC*  294


>XR_001658616.1 PREDICTED: Nicotiana tabacum uncharacterized LOC107832645 (LOC107832645), 
ncRNA
Length=509

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 39/78 (50%), Gaps = 4/78 (5%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M  K    + F FL L V+ E+   EA  C+  + T+ GPC  TG+C   CKN+E    G
Sbjct  59   MSNKVFLAILFCFL-LIVSNEMQGGEAKVCQRRSKTWSGPCINTGNCSRQCKNQEDARFG  235

Query  61   RCRDD---FRCWCTKNC*  75
             C      F C+C  NC*
Sbjct  236  ACHRSGIGFACFCYFNC*  289


>XM_012216514.1 PREDICTED: Jatropha curcas defensin-like protein 19 (LOC105633828), 
mRNA
Length=295

 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 42/80 (53%), Gaps = 5/80 (6%)
 Frame = +1

Query  1    MDKKSLAGLCFL--FLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLV  58
            M K   + LCFL  FL L V++E+AV+EA  C+  + T+ G C   G C+  C+N E   
Sbjct  1    MAKLHSSALCFLIIFLFLLVSKEMAVTEAKLCQRRSKTWSGFCGDPGKCNRQCRNWEGAS  180

Query  59   SGRCR---DDFRCWCTKNC*  75
             G C      F C+C   C*
Sbjct  181  HGACHAQFPGFACFCYFKC*  240


>XM_010676851.1 PREDICTED: Beta vulgaris subsp. vulgaris defensin-like protein 
1 (LOC104891192), transcript variant X2, mRNA
Length=609

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 4/76 (5%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            MD++ L GLC LFLVLF A ++  +E   C++ +  ++GPC    +C   C+N E    G
Sbjct  98   MDRR-LFGLCILFLVLF-ASQVKQAEGRVCQSRSHYFKGPCARDHNCAYVCRN-EGFSGG  268

Query  61   RCRDDF-RCWCTKNC*  75
            RC   F RC+CT+ C*
Sbjct  269  RCHGFFRRCYCTRLC*  316


>XM_014652387.1 PREDICTED: Vigna radiata var. radiata defensin Ec-AMP-D2-like 
(LOC106767483), mRNA
Length=525

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +2

Query  6    LAGLCFLFLVLFVAEEIA---VSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRC  62
            L    FLFL+L VA E+    V+EA  CE+ +  ++GPC +  +C   C+  E    G C
Sbjct  83   LVSTIFLFLLLLVATEMGPTMVAEARTCESQSHRFKGPCVSNTNCASVCRT-ERFTGGHC  259

Query  63   RD-DFRCWCTKNC*  75
            R    RC+CTK+C*
Sbjct  260  RGFRRRCFCTKHC*  301


>XM_009760689.1 PREDICTED: Nicotiana sylvestris defensin-like protein 1 (LOC104211603), 
mRNA
Length=294

 Score = 49.3 bits (116),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 4/78 (5%)
 Frame = +2

Query  1    MDKKSLAGLCFLFLVLFVAEEIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSG  60
            M  K +  + F FL L  + E+   EA  C+  + T+ GPC  TG+C   CKN+E    G
Sbjct  59   MSNKVILAILFCFL-LIASNEMQGGEAKVCQRRSKTWSGPCINTGNCSRQCKNQEDGRFG  235

Query  61   RCRDD---FRCWCTKNC*  75
             C      F C+C  NC*
Sbjct  236  ACHRSGIGFACFCYFNC*  289


>XR_741318.1 PREDICTED: Solanum lycopersicum defensin-like protein 1 (LOC104647220), 
transcript variant X3, misc_RNA
Length=332

 Score = 49.3 bits (116),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  21   EIAVSEAARCENLADTYRGPCFTTGSCDDHCKNKEHLVSGRCRDDF  66
            EI  +E+  CE ++ T+ GPCF TG C++ C N EH + G C  D+
Sbjct  36   EIQKAESIGCEKMSVTWSGPCFDTGGCNNQCINWEHAIHGACHWDW  173



Lambda      K        H
   0.335    0.143    0.514 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1062327875440


  Database: Nucleotide collection (nt)
    Posted date:  Oct 4, 2016  2:28 PM
  Number of letters in database: 128,339,311,604
  Number of sequences in database:  39,204,206



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40